KEGG   Bradyrhizobium sp. BF49: BF49_1737Help
Entry
BF49_1737         CDS       T04337                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase EC 41131
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
brad00620  Pyruvate metabolism
brad00680  Methane metabolism
brad00710  Carbon fixation in photosynthetic organisms
brad01100  Metabolic pathways
brad01120  Microbial metabolism in diverse environments
brad01200  Carbon metabolism
Module
brad_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:brad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BF49_1737
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BF49_1737
   00680 Methane metabolism
    BF49_1737
Enzymes [BR:brad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BF49_1737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CUT10657
UniProt: A0A160U5F8
LinkDB All DBs
Position
I:complement(1807889..1810678)
Genome map
AA seq 929 aa AA seqDB search
MSLQTISSDTADQRPNRPEDVQALEADVRLRDDIRLLGRILGDTVRDQEGADVFDLVERI
RQTSIRFHRDEDRLARRELEQILDSMSTSETVRIVRAFSYFSHLANIAEDQNNIRQMRAN
KGGGSGVLAETLAHARAAGIGADALRNFFKSALVSPVLTAHPTEVRRKSTMDREMEVASL
LDRRERVALTAEEAAASDEQLRREVLTLWQTNLLRRTKLTVLDEVANGLSFYDYTFLREV
PRLVNALEDRLEEGGDQAAGELASFLRMGSWIGGDRDGNPFVTADVMRGTLRLQSSRVMQ
FYLNELHVLGSELSIAAHLADVSEELRTLAERSPDTSPHRSGEPYRLAVSGIYARLTATA
EMLQVEITRRPVGKGAPYDSVGELKADLDVLHRSLISNNAGVIARGRLRLLRRAVDCFGL
HLARLDIRQNSAVHERTIAELMDAANPGMSYLALGEDARISLLTNELRSTRSLVSPFVKY
SDETMGELNVFHAAAEAHAKFGSDAIPQCIISMCKGMSDMLEVAVLLKEVGLVHPSGRSA
INIVPLFETIEDLQASSAIMDRMLSLHDYRRLVDSRGSVQEVMLGYSDSNKDGGFVTSGW
ELYKAEIGLVDVFERHGVRLRLFHGRGGSVGRGGGPSYDAIIAQPGGAVNGQIRITEQGE
IISSKYSNAEVGRNNLEILAAATLEASLLHPRQSAPRREYLTAMDELSNLAFKAYRGLVY
ETDGFVDYFWASTVINEIATLNIGSRPASRKKTRAIEDLRAIPWVFSWAQCRLMLPGWYG
FGSAVEQWIAEHPDKGMPFLKELYREWPFFRMLLSNMDMVLAKSSIAIASRYAELVPDEA
LREKIFGRIRREWHSCIETLLDIMGQDRLLQGNPLLERSVRHRFPYLDPLNHVQVELLKE
HRAQNPDEQVLRGIQLTINGISAGLRNTG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgtccctccagaccatatcgtccgacaccgccgaccagcgccccaaccgccccgaggat
gtccaggcgctggaagcggacgtgcggctgcgcgatgacatccgcctgctcgggcgcatc
cttggcgacacggtgcgcgaccaggagggcgccgatgtgttcgacctcgtcgaacgcatc
cggcagacctcgatccggttccaccgcgatgaggaccggctcgcccgccgcgagctcgag
cagatcctcgacagcatgtcgacctcggagacggtgcggatcgtccgcgccttcagctat
ttctcccacctcgccaacatcgccgaggaccagaacaacatccgccagatgcgcgccaac
aagggcggcggctccggcgtgctggccgagacgctcgcccatgcgagggctgcgggcatc
ggtgccgatgccctgcgcaacttcttcaagagcgcgctggtcagcccggtgctgaccgcg
catccgaccgaggtccggcgcaagagcaccatggaccgcgagatggaggtagctagcctg
ctcgatcgtcgcgagcgcgtcgcgctgacggcggaggaggccgccgccagcgacgagcag
ctccgccgcgaggtgctgacgctgtggcagaccaatctgctgcgccggaccaagctcacc
gtgctcgacgaggtcgccaacggcctgtcgttctacgattacacgttcctgcgcgaggtg
ccgcggctcgtcaacgcgctggaggaccggctggaggagggcggcgatcaggcggccggc
gagctcgcctcgttcctgcgcatggggagctggatcggcggcgaccgcgacggcaatccc
ttcgtcaccgccgacgtgatgcgcggcacgctgcggctgcagtcgagccgggtgatgcag
ttctatctgaatgagctgcacgtgctcggctccgagctgtcgatcgcggcccatctcgcc
gacgtgtccgaggagttgcgcacgctggcggagcgctcgcccgatacctcgccgcaccgg
agcggcgagccctatcgcctcgcggtctccggcatctatgcgcgcctcaccgccacggcc
gaaatgcttcaggtcgagatcacgcgccggcctgtcggcaagggcgcgccgtatgacagc
gtcggtgagctcaaggccgatctcgacgtgctgcaccgctcgctgatctccaacaacgcc
ggcgtcatcgcccgcggccggctgcggttgctgcggcgtgcggtggactgctttggatta
cacctagcccggctcgatatccgccagaactcggcggtgcacgagcgcaccattgccgag
ctgatggatgccgccaaccccggcatgtcctatctcgcgctcggcgaggacgcgcgcatc
tccctgctcaccaacgaattgcgctcgacgcggtcgctggtgtcgccattcgtcaagtac
agcgacgagaccatgggcgagctcaacgtcttccatgcggccgccgaggcgcatgcgaag
ttcggctcggacgccattccccaatgcatcatctcgatgtgcaagggcatgtcggatatg
ctcgaggtcgcggtgctcctgaaggaggtcggcctcgtccatccctccgggcgcagcgcc
atcaacatcgtgccgctgttcgagaccatcgaggatttgcaggcctccagcgccatcatg
gaccgcatgctctcgctgcacgattaccgccgcctggtcgacagccgcggcagcgtgcag
gaggtcatgctgggctattccgactccaacaaggatggcggcttcgtcacctcgggctgg
gagctctacaaggccgagatcggcctcgtcgacgtgttcgagcgccacggcgtgcggctg
cgcctgttccatggccgcggcggttcggtcggccgcggcggcggcccgagctatgatgcc
atcatcgcccagccgggcggcgcggtgaacggccagatccgcatcaccgagcagggcgag
atcatctcgtcgaaatattccaacgccgaagtcggccgcaacaatctggagatcctggcc
gccgcgacgctggaggcgagcctgctgcatccgcgccagagcgcgccgcgccgcgaatat
ctgaccgccatggacgagctttcaaacctcgccttcaaggcctatcgcggcctcgtttac
gagaccgacggcttcgtcgattatttctgggcctcgaccgtcatcaacgagatcgcaacg
ctcaacatcggcagccgtccggcgtcgcgcaagaagacccgggcgatcgaggaccttcgc
gccattccctgggtgttctcctgggcgcaatgccgcctgatgctgcccggctggtatggc
tttggcagcgcggtcgagcagtggatcgcggagcatcccgacaagggcatgccgttcctc
aaggagctctacagggaatggccgttcttccgcatgctgttgtcgaacatggacatggtg
ctggccaagagctcgatcgcgatcgcctcgcgctatgccgagctcgtgcccgacgaggcg
ctccgcgaaaaaatcttcggccgaatccgccgcgaatggcattcctgcatcgagacgctt
ctggacatcatgggacaggaccggctgctgcaaggcaacccgctgctggaacgctcggtg
cgccaccgcttcccctatctcgacccgctcaaccatgtgcaggtcgagctgctgaaagag
caccgcgcgcagaacccggacgagcaggtgctgcgcgggattcagctgacgatcaacgga
atctcggcggggctgaggaacacgggttga

DBGET integrated database retrieval system