KEGG   Bradyrhizobium sp. BF49: BF49_2365Help
Entry
BF49_2365         CDS       T04337                                 

Definition
(GenBank) Aerobic glycerol3phosphate dehydrogenase EC 1153
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
brad00564  Glycerophospholipid metabolism
brad01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BF49_2365
Enzymes [BR:brad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BF49_2365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CUT11285
UniProt: A0A160U808
LinkDB All DBs
Position
I:complement(2485618..2487168)
Genome map
AA seq 516 aa AA seqDB search
MRLLERIFDLAIIGGGVNGCGIARDAVGRGNTVFLCEMNDLASGTSSWSTKLVHGGLRYL
EYYEFRLVREALIEREILWGIAPHIIRPLRFVLPHHAGLRPAWLLRLGLFLYDHIGGRHL
LPATRSVDLGRDEVGRPLIPNRYGRAFEYSDCFVDDARLVVLNARDAADKGAEIRTRTRA
TDIKQSDGIWTVGMIDTLTGARSSIQARALVNAGGPWVEDVLGRGAGVNAKAKVRLVQGS
HIVVKKLYDHDRAYMFQNADGRIIFVIPYQDDFTLIGTTDRDYDGDPAKVKATAEEIQYL
CTAASEYLAKPVTPDDVVWTYSGVRPLYDDGASEAKAATRDYVFELDTPGGVPLLSIYGG
KITTYRRLAEEALERLAPYLRSAKAREGWTGKWPLPGGDMGVSDVDGLIAELQRGYPFLS
HEHARRLARAYGTRAIKLLGDAKSAADLGQAFGATLTEREVRYLMANEWAVTADDVVWRR
SKLGLRLSADEIAALDDWIRTHAVQQSPLLEAGGRS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgttggagcgtatttttgacctcgccattattggaggcggtgttaacggctgt
ggcatcgcgcgcgacgcggtgggccgcggcaacacggttttcctgtgcgaaatgaacgat
ctggcgagcgggacctcgtcctggtcgaccaagctggtgcatggcggcctgcgctatctc
gaatattacgagtttcggctggtccgcgaggcgctgatcgagcgcgagattctctggggc
atcgcgccccacatcatccgccccctgcgtttcgtcttgccgcaccatgcgggcttaagg
ccagcttggctgctgcgcctcggcctcttcctctatgaccacatcggcggccgtcatctg
ttgccggcgacgcgctcggtcgaccttgggcgtgacgaggtcggccggccgctgatcccc
aaccgctacggccgcgcattcgaatattccgactgcttcgtcgacgacgcccgtctcgtc
gtgctcaacgcgcgcgatgccgccgacaagggcgccgagatccgcacccgcacgcgcgca
acggatatcaaacaatcagacggcatctggaccgtcggcatgatcgacacgctgacaggc
gcgcgctcgtcgatccaggcccgtgcgctggtcaatgccggcgggccctgggtcgaggat
gtgctcggccgcggcgccggcgtcaacgcgaaagccaaggtacgcctggtgcagggctcg
cacatcgtcgtgaaaaaactctatgaccacgaccgcgcctacatgttccagaatgccgat
ggccgcatcatcttcgtcattccctatcaggacgattttacgctgatcggcaccaccgac
cgcgactatgacggcgatcccgccaaggtgaaggcgacggccgaggagatccagtatctc
tgcacggcagcaagcgaatatctggccaagcctgtcacgcccgacgacgtggtctggacc
tattccggtgtgcgtccgctctacgacgacggcgccagcgaagccaaggccgcgacgcgc
gattatgtgttcgagctcgacacgcccggcggcgtgccgctgctgtcgatctatggcggc
aagatcacgacctaccgccgtctcgccgaggaggcgctggagcggctcgcgccctatctt
cgcagtgcgaaagcgcgcgaaggctggaccggcaaatggccgctgcccggcggcgacatg
ggcgtgtccgacgtcgacggcctgatcgccgagcttcagcgcggctatcctttcctcagc
cacgagcatgcgcggcgcctcgcacgcgcctatggcacgagggcgatcaagctgcttggg
gatgcgaaatcggcggccgatctcggccaggccttcggtgcgacgctgaccgagcgcgaa
gtccgctatctcatggccaacgaatgggccgttaccgccgacgacgtcgtctggcgccgt
tccaagctcggcctgcgactaagtgccgacgagatcgcggcgcttgacgactggatcagg
acccacgccgtgcagcaaagtcccctgctggaagcaggaggacgctcatga

DBGET integrated database retrieval system