KEGG   Bradyrhizobium sp. BF49: BF49_3924Help
Entry
BF49_3924         CDS       T04337                                 

Definition
(GenBank) Potassium efflux system KefA protein Smallconductance mechanosensitive channel
Organism
brad  Bradyrhizobium sp. BF49
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MS_channel
Motif
Other DBs
NCBI-ProteinID: CUT12844
UniProt: A0A170PY21
LinkDB All DBs
Position
I:complement(4030968..4032284)
Genome map
AA seq 438 aa AA seqDB search
MDMDLKDFMEFVQTTARSVGAEISSPWFYLQFGLILAAAGIAYAAEAAVRSRVDMTSLAM
RWPLPLRHFARVMVASASTAAFTLLVIVSRVVMYHATWPSRSYLLMVAAKLGLAWLAIRL
LTSVLRNAFIVKLVSITAWFVAALSILGELDATVDLLDSFAIVLGGLRLTPLLVIKAGAL
LLIALWLTNIASNFAESRINSTTDLTPSVQVLLVKIIRIGLLAVAIVIALGTVGIDLSAL
AVFSGAVGVGIGIGLQKIVANFISGIILLADKSVKPGDLVTIGDNTGRISAMKTRYISVA
AGDGREFLVPNEDLVTQKVVNWTYTDKNTLVKIAFGTNYDADPRLVCKLAAETAAAHPRA
QKGKPPNCILTEFAEAGMKFSLTFWIADPDGMDNVKSDVMLALWDAFKREGIRVPYPVRE
IRVRGGALPVETTVEVPN
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggacatggacctcaaagacttcatggagttcgtgcagaccaccgcgcgcagcgtcggg
gccgaaatctcctcaccctggttctacctgcaattcgggctcattctggccgcggccggc
atcgcctatgccgcggaagccgccgtccgcagccgcgtcgacatgacctcgctggcgatg
cgctggccgctgccgctccggcacttcgcccgggtgatggtcgccagcgcctcgacggcg
gcgttcacgctgcttgtgatcgtctcgcgcgtggtcatgtaccacgcgacctggccgagc
cgcagctatctcctgatggtcgccgccaagctggggttggcctggctcgcgatccggctc
ttgacctcggtgctgcgcaacgccttcatcgtcaagctggtgtcgatcacagcctggttc
gtcgcggcgctctcgatcctcggcgagctcgatgcgacggtcgacctgctcgactccttc
gccatcgtgctcggcggcctgcggctgacgccgctgctggtgatcaaggccggcgcgctg
ctgctcatcgcgctctggctcaccaacatcgccagcaatttcgccgagagccggatcaac
tcgaccaccgatctgacgccatcggtacaggtgctgctggtcaagatcatccgcatcggc
ctgcttgcggtcgcgatcgtgatcgcgctcggcacggtcggcatcgatctctcggcgctc
gcggtgttctccggtgcggtcggcgtcggcatcggtatcggcctgcagaagatcgtcgcc
aatttcatctcgggcatcatcctgctcgccgacaaatcggtgaagcccggcgatctcgtc
accatcggcgacaacaccgggcggatcagcgcgatgaagacgcgctatatttccgtcgcc
gccggcgatggccgcgaattcctggtgccgaacgaggatctggtgacgcagaaggtggtc
aactggacctacaccgacaagaacacgctggtgaaaatcgccttcggcaccaattacgac
gcggacccgcggctggtctgcaagctcgccgccgagaccgcggccgctcatccgcgcgca
cagaagggcaagccgccaaattgcatcctgacggagttcgccgaagccgggatgaagttc
tcgctgaccttctggatcgccgaccccgacggcatggacaacgtcaagagcgacgtgatg
ctggcgctgtgggacgccttcaagcgcgagggcatccgggttccctatcccgtgcgcgaa
atccgcgtccgcggcggtgccctcccggtggaaaccaccgtagaagtcccgaattga

DBGET integrated database retrieval system