KEGG   Bradyrhizobium sp. BF49: BF49_3998Help
Entry
BF49_3998         CDS       T04337                                 

Definition
(GenBank) Glutathione Stransferase EC 25118
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
brad00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:brad00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BF49_3998
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brad02000]
    BF49_3998
Enzymes [BR:brad01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BF49_3998
Transporters [BR:brad02000]
 Other Transporters
  Pores ion channels [TC:1]
   BF49_3998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_2 GST_N_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: CUT12918
UniProt: A0A161K380
LinkDB All DBs
Position
I:complement(4118806..4119420)
Genome map
AA seq 204 aa AA seqDB search
MKLYYSPGACSLSPHIALLEAGLPYELVKVDIRAKKLENGEDYLKLNPKGQVPALGLDSG
EIVTEGPVIVQMIADQASAKALAPAHGSSERYKLLEWLNFLTSEVHKSFGPMFAPALNDE
AKAFFKDRVMGKLKYIDSQLAGRDYLMGKQFTVADGYLFTMLTWGDRMKFDLSAMPNLAA
YKTRVAARPQVQEAMKKEGLIQAA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtactattcgcccggtgcctgctcgctatccccccatatcgcgctcctggaa
gccggcctgccctatgaactggtcaaggtcgatatccgggccaagaagctcgaaaacggt
gaggattatctgaagctgaaccccaagggccaggtccctgcgctgggcctcgatagcgga
gagatcgtgaccgaaggcccggtgattgtccagatgatcgccgatcaggcctcggccaag
gcgcttgcgccggcccacggcagctccgagcgctacaagctgctcgaatggctgaacttc
ctcacctcggaggtccacaagagcttcggcccgatgttcgcgccagcgctgaacgacgag
gccaaggccttcttcaaggaccgcgtcatgggcaagctgaaatacatcgacagccagctc
gccggccgcgactacctcatgggcaagcagttcacggtggctgacggctatctcttcacg
atgctgacctggggcgaccggatgaagttcgacctctcggcgatgccgaaccttgccgcc
tacaagacccgcgtcgcggcgcggccgcaggtgcaggaagcgatgaagaaggaaggactg
attcaggctgcctga

DBGET integrated database retrieval system