KEGG   Bradyrhizobium sp. BF49: BF49_6228Help
Entry
BF49_6228         CDS       T04337                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
brad  Bradyrhizobium sp. BF49
Brite
Translation factors [BR:brad03012]
 Eukaryotic Type
  Elongation factors
   BF49_6228
 Prokaryotic Type
   BF49_6228
Mitochondrial biogenesis [BR:brad03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BF49_6228
Exosome [BR:brad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BF49_6228
  Exosomal proteins of breast cancer cells
   BF49_6228
  Exosomal proteins of colorectal cancer cells
   BF49_6228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CUT15148
UniProt: A0A170Q036
LinkDB All DBs
Position
I:6390857..6392047
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAEAGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETKNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKCDMVDDPELLELVELEVRELLSKYEFPGDTIPIIKGSALAALE
DSDKTLGHEAILELMKQVDAYIPQPERPVDLPFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGLRATQKTTVTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcaaagtttgaacgtaacaagccgcactgcaacatcggcaccatcggtcac
gtcgaccatggcaagacgtcgctgaccgcggcgatcaccaaggtcctcgccgaagccggc
ggcgcgacgttcacggcgtacgaccagatcgacaaggcgccggaagagaaggcgcgcggt
atcacgatctcgacggcgcacgtcgaatacgaaaccaagaaccgccactacgcgcacgtc
gactgccccggccacgccgactacgtgaagaacatgatcaccggcgctgcccagatggac
ggtgcgatcctggtcgtgtcggccgctgacggtccgatgccgcagacccgcgagcacatc
ctgctcgcccgccaggtcggcgttcccgcgctcgtcgtgttcctcaacaagtgcgacatg
gtcgacgatccggaactgctcgaactcgtcgagctcgaggtgcgcgagctgctctcgaag
tacgaattcccgggcgacaccatcccgatcatcaagggttcggcgctcgccgctctcgaa
gattccgacaagacgctcggccatgaggccatcctcgagctgatgaagcaggtcgacgcc
tacattccgcagccggagcgtccggtcgacctgccgttcctgatgccggttgaagacgtg
ttctcgatctcgggccgcggcaccgtcgtgaccggccgtgtcgagcgcggtatcgtcaag
gtcggcgaggaaatcgagatcgtcggtctgcgcgccacgcagaagaccacggttaccggc
gtcgaaatgttccgcaagctgctcgatcagggccaggccggcgacaacatcggtgcgctg
cttcgcggtaccaagcgcgaggacgtcgagcgcggccaggtgctgtgcaagccgggttcg
gtcaagccgcacaccaagttcaaggctgaggcctacatcctcaccaaggaagagggcggc
cgccacaccccgttcttcaccaactaccgtccgcagttctacttccgcaccaccgacgtg
accggtgtcgtgcatctgccggaaggcaccgagatggtgatgccgggcgacaacatcgcg
atggaagtgcacctgatcgtgccgatcgcgatggaagagaagctccgcttcgcgatccgc
gaaggtggccgcaccgtcggcgccggcgtcgtcgcctcgatcatcgagtaa

DBGET integrated database retrieval system