KEGG   Bradyrhizobium sp. BF49: BF49_6412Help
Entry
BF49_6412         CDS       T04337                                 

Definition
(GenBank) DalanylDalanine carboxypeptidase EC 34164
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
brad  Bradyrhizobium sp. BF49
Brite
Enzymes [BR:brad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BF49_6412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 SPOR
Motif
Other DBs
NCBI-ProteinID: CUT15332
UniProt: A0A160UGP9
LinkDB All DBs
Position
I:complement(6547887..6549590)
Genome map
AA seq 567 aa AA seqDB search
MQHDVSESSSPKFASIIVDGNSGSVLQATSPDGIRHPASLTKIMTLYLLFERLESGKMKL
DTEMPVSQHAADQDPTKLNLRAGQTIRVEDAIKGLVTRSANDAAVVIAEAIGGDEDDFAQ
MMTRKARSLGMSRTVYRNANGLPNDEQVTTARDQATLGRAIQERFPRYYRYFATSTFNWR
GQSIRNHNHLLGNVEGVDGIKTGYTRASGFNLVTSMRRGNRHLIGVVLGGRSGGSRDAIM
RNLLAENLDKAATTHTVAAVTERSGSDAAVEVADASDTPARSAPQVQAAAAPAPEAAPSR
LAARLSTLAAATAAVPPAQPRYEANRPEVRPTESKIEPAPLTNGVISSQPLSIIPGSSEP
MKPVRVKTVQVKAGAVKVASAAPAQIAPQVTSTIASRSDVAETSGAVVARADLINKPEVA
SQPEAPRAEIARTELPRQPAGFGTGNGILGVLPAAAPAPAAAKLASADPALQPIQMSATT
KPVATHSGWIVQVGALESENEAQQRIDAARSSARGLLSKADPFTEPVVAKDNRKLYRARF
AGLDRDQAEAVCRTLKRADISCMTVRN
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcacgatgtgtccgagagttccagcccgaaattcgcgtcgatcatcgtcgacggc
aattccggctccgtgcttcaggccacgagccccgacgggatccgccatccggcctcgctg
accaagatcatgacgctctatctgctgttcgagcgcctcgagtccgggaagatgaagctc
gacaccgagatgccggtgtcgcagcacgccgccgatcaggatccgaccaagctgaacctg
cgtgccggccagaccattcgcgtcgaggacgcgatcaagggtctcgtcacccgctccgcc
aacgacgcagccgttgtgatcgcggaagcgattggcggcgacgaggacgacttcgcccag
atgatgacgcgcaaggcgcgttcgctcggcatgtccagaacggtttaccgcaacgccaac
ggccttcccaacgacgagcaggtcacgaccgcgcgcgaccaggccacgctcggccgcgcc
atccaggagcgcttcccgcgctactatcgctatttcgcgacctcgacgttcaactggcgc
ggacagtcgatccggaaccacaatcatctgctcggtaatgtcgagggcgtggacggcatc
aagaccggctacacccgcgcctccggcttcaatctcgtgacctcgatgcgccgcggcaac
cgccacctgatcggcgtggtgctgggcggccgcagcggcggctcgcgcgacgccatcatg
cgcaacctgcttgcggagaacctcgataaggccgcgaccacccacaccgtcgcggcggtc
accgagcgcagcggctccgacgccgcggtcgaggttgccgatgcatcggacaccccggcc
cgctccgctccgcaggttcaggctgctgctgcccctgctcccgaagcagccccgtcgcgt
ctcgccgcgcgcctgtcgacgcttgcggctgcgactgccgcggtgccgccggctcagccc
agatatgaagccaacaggcctgaagttcggccgacagaatccaagatcgagcctgcgccg
ctcacgaatggcgtgatctcgagccagccgctctcgatcatccccggctcgtccgagccg
atgaagccggtcagggtcaagaccgtccaggtcaaggccggcgcggtgaaggtcgcctcc
gccgccccggctcagatcgcaccgcaggtcacgagcacgatcgcgtcgcgctccgacgtc
gccgaaacctccggtgccgtcgtcgcccgcgcagaccttatcaacaagccggaggtcgcc
agccaaccggaagccccgagggccgagatcgcccgtaccgagctgccgcggcagccggcg
ggcttcggcaccggtaacggcatcctcggcgtattgccggccgccgcacccgccccggct
gctgcgaagctcgcgtcagccgacccggcgctgcagccgatccaaatgagcgccaccacc
aagccggtcgccacccacagcggctggatcgtccaggtcggcgcgctcgagagcgagaac
gaagcccagcagcgcatcgacgcggcgcgcagctcggctcgcggcctgctcagcaaggcc
gacccgttcaccgagccggtcgtcgcgaaagacaatcgcaagctctaccgcgcccgcttc
gccgggctcgaccgcgaccaggccgaagccgtctgccgcaccctgaagcgcgccgatatc
tcctgcatgaccgtccgcaactga

DBGET integrated database retrieval system