KEGG   Bradyrhizobium sp. BF49: BF49_6711Help
Entry
BF49_6711         CDS       T04337                                 

Definition
(GenBank) 3hydroxyacylacylcarrierprotein dehydratase FabZ form EC 42159
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
brad00061  Fatty acid biosynthesis
brad00780  Biotin metabolism
brad01100  Metabolic pathways
brad01212  Fatty acid metabolism
Module
brad_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:brad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BF49_6711
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BF49_6711
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:brad01004]
    BF49_6711
Enzymes [BR:brad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BF49_6711
Lipid biosynthesis proteins [BR:brad01004]
 Fatty acid synthase
  Component type
   BF49_6711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: CUT15631
UniProt: A0A160ULN0
LinkDB All DBs
Position
I:6845388..6845849
Genome map
AA seq 153 aa AA seqDB search
MTDEAPVRFELVDINMILQTLPHRFPMLLIDRVINIRTDYSGIGIKNVTFNEPPFQGHFP
DRPVYPGVMMIEAMAQTAGVIGIKSVEGTEKPRAVYFLTIDKCKFRKPVLPGDTIEYHMR
SIGRRKAMWWFHGDAKVNGQVVAEADVGAMLTD
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgacggacgaagcaccggtcaggttcgagcttgtggacatcaacatgatcctgcaaacg
ctcccgcaccgttttccgatgctgctgatcgatcgcgtgatcaacatccgcaccgattac
agcggcatcggcatcaagaacgtcaccttcaacgagccgccgttccagggccactttccc
gatcgcccggtctatcccggcgtcatgatgatcgaagcgatggcgcagactgccggtgtg
atcggcatcaagtcggtcgagggcaccgagaaaccgcgcgcggtgtatttcctgaccatc
gacaagtgcaagttccgtaagccggtgctgcccggcgataccatcgaatatcacatgcgc
tcaatcggccgccgcaaggccatgtggtggtttcacggcgacgccaaggtcaacggccag
gtggttgcggaggccgacgtcggcgccatgctgaccgactga

DBGET integrated database retrieval system