KEGG   Bradyrhizobium sp. BF49: BF49_6762Help
Entry
BF49_6762         CDS       T04337                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex EC 23112 Dihydrolipoamide acyltransferase component of branchedchain alphaketo acid dehydrogenase complex EC 231168
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
brad00010  Glycolysis / Gluconeogenesis
brad00020  Citrate cycle (TCA cycle)
brad00620  Pyruvate metabolism
brad01100  Metabolic pathways
brad01110  Biosynthesis of secondary metabolites
brad01120  Microbial metabolism in diverse environments
brad01130  Biosynthesis of antibiotics
brad01200  Carbon metabolism
Module
brad_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:brad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF49_6762
   00020 Citrate cycle (TCA cycle)
    BF49_6762
   00620 Pyruvate metabolism
    BF49_6762
Enzymes [BR:brad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BF49_6762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N GCV_H HlyD_2 Fas_alpha_ACP
Motif
Other DBs
NCBI-ProteinID: CUT15682
UniProt: A0A160UHH4
LinkDB All DBs
Position
I:6901192..6902541
Genome map
AA seq 449 aa AA seqDB search
MPINILMPALSPTMEKGNLAKWLKKEGDKVKSGDVIAEIETDKATMEVEAIDEGTIARIL
VPEGTQDVPVNDVIAVLAGEGEDVKAAGAAKPSASAAPPKAAEAPTAAPAPAPAAPKAAP
PPAAAPAPQAAAPAAQSNGHAGRVFSSPLARRLAKEAGVDVAMVTGTGPHGRVVARDVEQ
AKSGKGLKAPAAAPSGAPASAPTMSDKQILSLFEPGSYEVVPHDGMRRTIAQRLTASIQN
VPHFYLTIDCDIGKLLAAREEINAAAPKDKEKKPLYKISVNDFVIKAMAVALQKIPNCNV
SWTESGMVKHHHSDVGVAVAMPGGLITPIIRKAETKTLSTISNEMKDFATRARSRKLKPE
EYQGGTTAVSNLGMFGISHFTAVINPPHATILAVGTSEERPVVRGGKIEIANMMSVTLSC
DHRAIDGALGAELIGAFKQLIENPVMMMV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcaacatcctgatgcccgctctttcgccgacgatggagaagggcaacctcgcc
aagtggctgaagaaggaaggcgacaaggtcaaatccggcgacgtcatcgccgagatcgag
accgacaaggcgaccatggaggtcgaggcgatcgacgagggcacgatcgccaggatcctc
gtgcccgagggcacgcaggacgtcccggtcaacgacgtgatcgcggtgctggccggcgaa
ggcgaggacgtgaaagcggcaggtgcggccaaacccagcgcttcggccgcgcctccgaaa
gctgctgaagctcccactgccgcaccggcgcccgcgcctgcagcccccaaggccgcgccg
ccgcccgctgccgcacctgcaccgcaggctgcagcaccggctgcgcagagcaacggccat
gccggccgcgtgttctcctcgccactggcgcgtcgtctcgccaaggaagccggcgtcgat
gttgcgatggtgaccggcaccggcccgcatggccgcgtcgtcgcacgcgacgtcgagcag
gcgaagtccggcaagggcctcaaggcgcccgccgcggcgccgtcaggcgcgcccgcgagc
gcgccgaccatgtcggacaagcagatcctgtcgctgttcgagccgggttcttacgaggtc
gtcccccatgacggcatgcgccgcacgatcgcgcagcgcctaaccgcgtcgatccagaac
gtcccgcacttctacctcaccatcgactgcgacatcggcaagctgctcgccgcgcgcgag
gagatcaatgcggctgctcccaaggacaaggagaagaagccgctctacaagatctcggtc
aacgacttcgtcatcaaggcgatggcggtggcgctgcagaagattccgaactgcaatgtg
agctggaccgaatccggcatggtcaagcaccaccattccgacgtcggcgtcgcggtggcg
atgcccggcggcctgatcacgccgatcatccgcaaggcggagaccaagacgctgtcgacc
atctcaaacgagatgaaggattttgcgacccgcgcccgctcgcgcaagctgaagcccgaa
gaataccagggcggcaccacggccgtctcgaacctcggcatgttcggcatcagccacttc
accgccgtgatcaatccgccacatgcgaccatcctcgcggtcggcaccagcgaggagcgg
cctgtggtccgcggcggcaagatcgagatcgcgaacatgatgagcgtgaccctgtcctgc
gatcaccgcgccatcgacggcgcgctcggcgccgaactgatcggtgccttcaagcagttg
atcgaaaaccctgtgatgatgatggtgtag

DBGET integrated database retrieval system