KEGG   Bradyrhizobium sp. BF49: BF49_6823Help
Entry
BF49_6823         CDS       T04337                                 

Definition
(GenBank) blr4704 putative phosphoglycolate phosphatase EC 31318
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
brad00630  Glyoxylate and dicarboxylate metabolism
brad01100  Metabolic pathways
brad01110  Biosynthesis of secondary metabolites
brad01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:brad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BF49_6823
Enzymes [BR:brad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     BF49_6823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Acid_PPase Hydrolase_6 Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: CUT15743
UniProt: A0A160UI36
LinkDB All DBs
Position
I:complement(6964652..6965326)
Genome map
AA seq 224 aa AA seqDB search
MLYSLAIFDLDGTLADSFPWFLRTINDVADRFGFRRVADEDVEGLRHASSREILSRLEVP
LWKLPAIARHARRLKAEAAAEIALFPGVEVMLRRLAESGVQLALVTSDSEANAREKLGEA
AALFAHFDCAASLFGKPSKFRRVMRRAGVAPGKVIAIGDEVRDIEAARAVGIACGAVGWG
YAAPAALRALAPDHMFERMDEIVWTLCPGAVARMSEATSGNAGG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgctctattccctcgccatcttcgatctcgacggcacgctggccgacagcttcccgtgg
ttcctgcgcaccatcaacgacgtcgccgatcgcttcggctttcgccgtgttgcggacgag
gatgtcgaggggctgcggcacgcttcgtcgcgcgagattcttagccggctcgaggtgccc
ctgtggaagctgccggcgatcgcgcggcatgcgcggcggctgaaggcggaggctgcggcg
gagattgcgctgtttccgggcgtcgaggtgatgttgcggaggctggcggagagcggcgtg
cagctggcgctggtgacctcggacagcgaagccaatgcacgcgaaaaactcggcgaagcc
gcggcgctgttcgcgcatttcgattgcgcggcatcgctgttcggcaagccgtcgaaattt
cgccgcgtcatgcggcgcgccggcgtggcgcctggcaaagtcatcgcgatcggcgacgag
gtccgcgacatcgaggcggcgcgagctgtcggcattgcctgcggcgcggtcggctggggt
tatgcggcgccggcggcgctgcgggcgctggcaccggatcacatgtttgagcggatggat
gagattgtgtggacgctgtgccccggtgcagtagcccggatgagcgaagcgacatccggg
aacgccggtggatga

DBGET integrated database retrieval system