KEGG   Brenneria rubrifaciens: EH207_15150Help
Entry
EH207_15150       CDS       T05976                                 

Gene name
fadB
Definition
(GenBank) fatty acid oxidation complex subunit alpha FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
brb  Brenneria rubrifaciens
Pathway
brb00071  Fatty acid degradation
brb00280  Valine, leucine and isoleucine degradation
brb00281  Geraniol degradation
brb00310  Lysine degradation
brb00362  Benzoate degradation
brb00380  Tryptophan metabolism
brb00410  beta-Alanine metabolism
brb00640  Propanoate metabolism
brb00650  Butanoate metabolism
brb00903  Limonene and pinene degradation
brb00930  Caprolactam degradation
brb01100  Metabolic pathways
brb01110  Biosynthesis of secondary metabolites
brb01120  Microbial metabolism in diverse environments
brb01130  Biosynthesis of antibiotics
brb01200  Carbon metabolism
brb01212  Fatty acid metabolism
Module
brb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:brb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EH207_15150 (fadB)
   00650 Butanoate metabolism
    EH207_15150 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EH207_15150 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EH207_15150 (fadB)
   00310 Lysine degradation
    EH207_15150 (fadB)
   00380 Tryptophan metabolism
    EH207_15150 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EH207_15150 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EH207_15150 (fadB)
   00281 Geraniol degradation
    EH207_15150 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EH207_15150 (fadB)
   00930 Caprolactam degradation
    EH207_15150 (fadB)
Enzymes [BR:brb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EH207_15150 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EH207_15150 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EH207_15150 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     EH207_15150 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: QCR09737
UniProt: A0A4P8QRH2
LinkDB All DBs
Position
3395417..3397639
Genome map
AA seq 740 aa AA seqDB search
MLYQGETLYLSWVEDGIAELVFAATASVNKLDTRTVASLGKALDVLAAQKSLQGLLLRSD
KPAFIVGADITEFLSLFAAPVDKLHEWLSFANGIFNRLEDLPVPTLSAIKGYSLGGGCEC
ALATDFRIAATDLRIGLPETRLGIMPGFGGSVRLPRLLGADSALEIIAAGKEIGAEEALK
IGLVHAIVAEEKLNAAALKILKQAIAGDLDWQACRRPKLEALKLSKIEARMSFATAKATV
LRTAGKHYPAPMTAVKTIESAASLPRDAALRLETQNFVPLARSDAARALIGLFLNDQYVK
EKAKKRVGELSPPKQTAVLGAGIMGGAIAYQSACKGIPIRMKDINEKPLSLGMNKAAKLL
NKQLEGGKLDGMKMARVLANIHPTLDYAGFERIDIVVEAVVENPEVKASVLAETESQVGL
HTVLTSNTSTIPIAQLAASLKRPQNFCGMHFFNPVHRMPLVEIIRGPQTDEKTLSRVVAY
AGKMGKTPIVVNDCAGFFVNRVLFPYIAAFSLLIRDGADFREIDNVMEKQFGWPMGPAYL
LDVIGIDTAHHAQAVMSQGFPQRMAKNYRDAVDVLFDNQRFGQKNGQGFYRYQTDNKGKL
RKEQDESVEALLTAIGQPGKPLSTEEIIARMMIPMINEVARCLEEGIVDSPAEADIALVY
GLGFPPFHGGACRYLDTLGSARYLEMAQRLSSLGPLYQVPDGLKLKARSNESYYPLVAPH
ADIFQGNRHEGRKYGKRSDC
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgctttatcaaggggaaactctctaccttagctgggttgaagatggcattgcagagctg
gtgtttgccgccacagcttccgtcaataagttggatacccgcacggttgccagcctgggt
aaagcgttagacgttctggcggcacaaaaatcgttgcagggactgttattacgttcagac
aaacctgcgtttattgtcggcgcagatatcaccgagtttctctctttgtttgccgccccg
gtcgacaaacttcatgagtggctgagcttcgcgaacggcattttcaaccgtctggaagat
ttgccggtgcccacattatctgccattaagggctattcgctcggcggcggatgtgaatgt
gcattggccaccgattttcgcattgccgccacagatctgcgcatcggtttgcccgaaacc
aggctgggcattatgccgggttttggtggttcggtacgtctgccacgtctgttgggggct
gacagtgcgctggaaattatcgccgcaggcaaagagatcggcgcagaggaagcgttgaag
ataggtctggtgcatgcgattgtcgcagaggaaaaactcaacgcggccgcgctgaaaata
ttgaagcaggcgattgctggcgatctggattggcaggcctgtcgacgccccaaacttgaa
gcgttgaagctaagcaaaattgaagcgcgcatgagtttcgccacagcgaaagccacggtg
ttgcggaccgcaggaaaacattacccggcaccgatgacggcagtaaaaaccatcgaatcc
gcggcatccctgccacgcgatgccgcgttgcggcttgaaacgcaaaactttgtgccgttg
gctcgttcagatgccgcccgcgcgctgattggtctcttcctcaacgatcagtatgtaaaa
gagaaagcgaaaaagcgcgtcggcgagttgtcgccaccgaaacagaccgccgtgctgggc
gcggggattatgggcggcgcgattgcctaccaatccgcctgcaaaggcatcccgattcgc
atgaaggatatcaacgagaaaccactctcccttggcatgaacaaagcggcgaaactactg
aataaacaactggaaggcggcaagctggacggtatgaaaatggcgcgggtactcgccaat
attcatccaacgttggactatgccggttttgaacgcattgacatcgtcgttgaagcggtg
gttgaaaacccggaagtgaaggccagcgtactggctgaaaccgaatctcaggtaggcctg
catactgtgctgacttccaacacgtcgacgattcccattgcacagttggcagcgtcatta
aagcggccacagaacttttgcggcatgcatttctttaacccggttcaccgcatgccgctg
gtggaaattattcgcggcccgcaaacagatgaaaaaaccctctcccgcgtggtggcctac
gccggcaaaatggggaaaacccccattgtcgtcaacgactgcgctggcttctttgtcaac
cgcgtgctgtttccctacattgccgccttcagtttgctgatacgcgacggtgcggatttc
cgtgaaattgacaacgttatggagaagcaatttggctggccgatgggcccggcctacctg
ctggatgtaatcggcattgataccgctcaccacgcacaggccgtgatgtcgcaagggttc
ccgcagcgcatggccaaaaattatcgggacgctgtcgacgtgctgttcgacaatcagcgg
tttggccagaaaaacgggcagggcttctatcgctatcaaaccgacaataaaggaaaactg
cgtaaagaacaggatgaaagcgtcgaagcgctgctgaccgcgatcggccagccaggaaag
cctctcagcacggaagagattatcgcccggatgatgatcccgatgattaacgaggtggcg
cgctgtctggaagaaggcattgtcgacagtccggcggaagccgatatagcgctggtgtat
gggctgggtttcccgccattccacggcggagcatgccgctatctggatacgctcggcagc
gcgcgttatctggaaatggcgcagcggctgtcatcactggggccgctttatcaggttccc
gacggcctgaaactaaaagcaagaagtaatgaaagttattacccattggtcgcaccacac
gcggatatttttcagggcaaccggcatgaagggagaaaatatggaaaacgcagtgattgt
tga

DBGET integrated database retrieval system