KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_00265Help
Entry
BCCGELA001_00265  CDS       T04273                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:brc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BCCGELA001_00265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brc02000]
    BCCGELA001_00265
Enzymes [BR:brc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BCCGELA001_00265
Transporters [BR:brc02000]
 Other Transporters
  Pores ion channels [TC:1]
   BCCGELA001_00265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 p47_phox_C
Motif
Other DBs
NCBI-ProteinID: AMA54847
UniProt: A0A0X8CHP6
LinkDB All DBs
Position
61661..62257
Genome map
AA seq 198 aa AA seqDB search
MIKLYWSPRSRSFTTLWLMEESGLPYERVLTDISTGAQKAPEFLKVNPMGKVPALTDGDA
SLGEAAAICAYIADRYPEARLAPAVTDPRRARYLQWLFFSPGCIEPAIIQIFTKIEIPTS
TAAWGSATQVFDVLEAALEKGPWILGEDFSAADITIGSGLNFAVRLFKMVPPRPAFDAYL
ARCMARPAFQRAETIAAG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctttattggtcgcctcgctcgcgctcgttcacgacgctctggctgatggaa
gaaagcggcttgccctatgagcgcgtgctgaccgacatctcgaccggcgcgcagaaggcg
ccggaattcctcaaggtcaacccgatgggcaaggtgccggcgctgaccgacggcgacgca
tcgctcggcgaggcggctgcgatctgcgcctacattgccgatcgctatcctgaggccagg
ctcgcgcctgcggtgaccgatccgcgccgtgcgcgctatctgcaatggctgttcttctcg
ccgggctgcatcgagccggccatcatccagatcttcaccaagatcgagatcccgacctcg
accgcagcgtggggcagcgcgacccaggtcttcgacgtgctggaagctgcgctcgagaag
ggcccgtggattctcggcgaggatttctccgccgccgacatcaccatcggctcgggcctg
aatttcgcggtgcggctgttcaagatggtgccgccgcggccggccttcgacgcttacctt
gcgcgctgcatggcgcgcccggcattccagcgcgcggagacaatcgcggcgggttag

DBGET integrated database retrieval system