KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_00270Help
Entry
BCCGELA001_00270  CDS       T04273                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc00061  Fatty acid biosynthesis
brc00780  Biotin metabolism
brc01100  Metabolic pathways
brc01130  Biosynthesis of antibiotics
brc01212  Fatty acid metabolism
Module
brc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:brc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BCCGELA001_00270
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BCCGELA001_00270
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    BCCGELA001_00270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:brc01004]
    BCCGELA001_00270
Enzymes [BR:brc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BCCGELA001_00270
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BCCGELA001_00270
Lipid biosynthesis proteins [BR:brc01004]
 Fatty acid synthase
  Component type
   BCCGELA001_00270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AMA54848
UniProt: A0A109Q1Q4
LinkDB All DBs
Position
complement(62254..63054)
Genome map
AA seq 266 aa AA seqDB search
MEGLMKGKRGLIMGIANDHSIAWGMAKTLHAHGAELAFTFQGEALGKRVKPLAEQLGVDL
VLPCDVEDIASVDATFAALRDKWGKLDFVIHAIGFADKNELKGRYADTSRENFSRTMVIS
CFSFTEIAKRAAELMTEGGSMITLTFGASERAMPNYNVMGVAKAALEASVRYLAADFGPR
GIRVNAISAGPIRTLAGSGIGEARAMFAYMQKHAPLRRGVTLDELGGSALYLLSDLSGGV
TGEIHYVDSGYNVILMPRPDDLKTQD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtttgatgaagggcaagcgcggtctgatcatgggcatcgccaatgatcattcg
atcgcctggggcatggcgaagacgctgcatgcccacggtgccgagctggccttcaccttc
cagggtgaggccctcggtaaacgcgtcaagccgctggcggagcagctcggcgtcgatctg
gtgctgccgtgcgacgtcgaggacatcgccagcgtcgatgcgaccttcgcggcgctccgc
gacaagtggggcaagctcgacttcgtgatccacgcgatcggcttcgccgacaagaacgag
ctgaagggccgctacgccgacaccagccgcgagaacttttcgcgcaccatggtgatctcc
tgcttctcgttcacagagattgcgaagcgtgcggccgaactgatgaccgaaggcggcagc
atgatcacgctgaccttcggcgcgtcggaacgcgcgatgccgaattacaacgtgatgggc
gtggccaaggcggcgctggaagcctccgtgcgctatctcgccgccgatttcggaccgcgc
ggcatccgcgtcaatgcgatctccgcaggtcccatccgcacgctcgccggctcaggcatc
ggcgaggcgcgcgcgatgttcgcctacatgcagaagcatgcgccgctgcgccgcggcgtc
acgctcgacgagctcggcggctcggcgctgtatctgctgtcggacttgtccggcggcgtc
accggcgagatccactatgtcgattccggctacaacgtcatcctgatgccgaggccggac
gatttgaagacgcaggactaa

DBGET integrated database retrieval system