KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_05705Help
Entry
BCCGELA001_05705  CDS       T04273                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc00020  Citrate cycle (TCA cycle)
brc00190  Oxidative phosphorylation
brc00650  Butanoate metabolism
brc01100  Metabolic pathways
brc01110  Biosynthesis of secondary metabolites
brc01120  Microbial metabolism in diverse environments
brc01130  Biosynthesis of antibiotics
brc01200  Carbon metabolism
Module
brc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
brc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
brc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:brc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCCGELA001_05705
   00650 Butanoate metabolism
    BCCGELA001_05705
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BCCGELA001_05705
Enzymes [BR:brc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BCCGELA001_05705
    1.3.5.4  fumarate reductase (quinol)
     BCCGELA001_05705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_9
Motif
Other DBs
NCBI-ProteinID: AMA61065
UniProt: A0A0X8CP84
LinkDB All DBs
Position
1192470..1193255
Genome map
AA seq 261 aa AA seqDB search
MVEFRLPKNSRLERGTVWPKPRSESLREFHVYRWNPDDGRNPRLDTYFVDSTDCGPMVLD
GLIWIKNNVDSTLTFRRSCREGVCGSCSMNIAGQNTLACTKSMSDDISEGEPLRVLPLPH
QPVVKDLVPDLTNFYAQLALVEPWLQTTSPTPPKEWRQSHEDRAKLDGLYECILCACCST
SCPSYWWNSERFLGPAALIQAARWINDSRDEATGERLDMLEDPFRIYRCHTILNCAKACP
KGLNPGEAIAALRLKMVERKF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggttgagttcaggcttccgaaaaactcccgcctcgagcgagggaccgtttggccaaag
ccgcgcagcgaaagcttgcgcgagtttcacgtctatcgctggaatcccgacgatgggcgc
aatccccggctcgacacctattttgtcgactcgacggattgcggaccgatggtgctggac
ggcctgatctggatcaagaacaacgtcgattcgacattgacgttcaggcgatcctgccgc
gagggcgtgtgcggctcctgctcgatgaacatcgccggccagaacaccctggcctgcacc
aaatccatgagtgacgatatttcggaaggtgagccgctccgcgtgctgcccttgccgcat
cagcctgtcgtgaaggatctggtgcccgacctcaccaatttctatgcgcaactcgccctg
gtcgagccgtggctgcagaccacctcgcccacgccgccgaaggaatggcggcaaagccat
gaggatcgggcaaagcttgatggactgtacgagtgcattctctgcgcctgctgctcgacc
tcgtgcccgagctactggtggaattccgagcgcttcctcggacccgctgccctgattcag
gccgcgcgctggatcaacgacagccgggacgaggcgacaggcgagcgcctcgacatgctc
gaggaccccttcaggatctaccgctgccacaccatcctcaattgcgccaaggcatgtcca
aagggtctcaatcccggcgaagccatcgccgccttgcgcctcaagatggtcgagcggaag
ttctga

DBGET integrated database retrieval system