KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_11200Help
Entry
BCCGELA001_11200  CDS       T04273                                 

Gene name
rbcL
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc00630  Glyoxylate and dicarboxylate metabolism
brc00710  Carbon fixation in photosynthetic organisms
brc01100  Metabolic pathways
brc01120  Microbial metabolism in diverse environments
brc01200  Carbon metabolism
Module
brc_M00165  Reductive pentose phosphate cycle (Calvin cycle)
brc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:brc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BCCGELA001_11200 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BCCGELA001_11200 (rbcL)
Enzymes [BR:brc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BCCGELA001_11200 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N OMPdecase
Motif
Other DBs
NCBI-ProteinID: AMA56759
UniProt: A0A0X8CGK9
LinkDB All DBs
Position
2392252..2393712
Genome map
AA seq 486 aa AA seqDB search
MNAHAGTVRGKERYRSGVMEYKRMGYWEPDYTPKDTDVIALFRVTPQEGVDPIEASAAVA
GESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPGSPGSYFAYIAYDLDLFEPGSIANLSA
SIIGNVFGFKPLKALRLEDMRFPVAYVKTFQGPATGIVVERERLDKFGRPLLGATVKPKL
GLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRDRFLYCMEAVNRAQAASGEVKGT
YLNVTAGTMEDMYERAEFAKELGSVIVMVDLVIGYTAIQSMAKWARRNDMILHLHRAGHS
TYTRQKSHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPNTTRGYYDVCREEFNPTRLE
HGIFFDQSWASLNKMMPVASGGIHAGQMHQLLDLLGEDVVLQFGGGTIGHPMGIAAGAIA
NRVALEAMILARNEGRDYVHEGPEILAKAAQTCTPLKSALDVWKDVTFNYQSTDTPDFVP
TALETV
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacatgcaggcacggtccgcggcaaagagcgctatcgctccggcgtgatggaa
tacaagcgcatgggctattgggagcccgattacacgccaaaggacacggacgtcatcgcg
ctgttccgcgtcacgccgcaggaaggtgtcgatccgatcgaagcgtcagctgcggtggcc
ggtgaatcctcgaccgcgacctggaccgtggtgtggaccgaccgcctgaccgccgcggag
aaatatcgcgccaagtgctaccgcgtcgatccggtgccgggctcgccaggctcgtatttc
gcctacatcgcctatgatctcgacctgttcgagccgggctcgatcgccaatctgtcggct
tccatcatcggcaacgtgttcggcttcaagccgctcaaggcgctgcggctggaggacatg
cgcttcccggtcgcctatgtgaagacgttccaggggccggcgaccggcatcgtggtcgag
cgcgagcgcctcgacaagttcggccggccgctgctgggcgcaacggtgaaaccgaagctc
ggactctccgggcgcaactacggccgcgtggtctacgaggcgctcaagggcgggctcgac
ttcaccaaggacgacgagaacatcaactcgcagcccttcatgcattggcgcgaccgtttc
ctctactgcatggaggcggtgaatcgcgcgcaggcagcctccggtgaggtgaagggcact
tacctcaacgtcaccgcgggaacgatggaggacatgtacgagcgcgcggagttcgccaag
gagctcggctccgtcatcgtcatggtcgacctcgtgatcggctacaccgcgatccagtcg
atggcgaagtgggcgcgacgcaacgacatgatcctgcatctgcatcgcgcgggtcactcg
acctatacgcggcagaagagccacggcgtctcgttccgcgtcatcgccaaatggatgcgg
ctcgccggtgtcgaccacatccatgccggcacggtggtcggcaagcttgagggcgacccc
aacaccacgcgcggctattacgacgtctgtcgcgaggagttcaacccgaccaggctcgag
cacggcattttcttcgaccagtcctgggcgagcctgaacaaaatgatgccggtcgcctcg
ggcggcatccatgccggccagatgcatcagctgctcgatctcctgggtgaggacgtcgtg
ctacaattcggcggtggcaccatcggccatcccatgggaatcgcggccggcgccatcgcc
aaccgcgtcgcgctggaagcgatgatcctcgcccgcaacgagggccgcgactacgtccac
gagggcccggagatcctggccaaggccgcccagacctgcacgccgctgaagtctgcgctc
gatgtctggaaggacgtcaccttcaattatcaatccaccgacacgccggacttcgtgccg
acggcgctggaaaccgtctga

DBGET integrated database retrieval system