KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_20320Help
Entry
BCCGELA001_20320  CDS       T04273                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc00010  Glycolysis / Gluconeogenesis
brc00620  Pyruvate metabolism
brc01100  Metabolic pathways
brc01110  Biosynthesis of secondary metabolites
brc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:brc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCCGELA001_20320
   00620 Pyruvate metabolism
    BCCGELA001_20320
Enzymes [BR:brc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BCCGELA001_20320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AMA58380
UniProt: A0A0X8CJ25
LinkDB All DBs
Position
complement(4403485..4405002)
Genome map
AA seq 505 aa AA seqDB search
MNKVEFLSVTKVPFAERYDNFIGGKFVAPISGKYFDNASPVTGQIVCKIARSDAQDVEAA
LDAAHAAKAAWGRTSVAERAAVLNRIADRMEENLERLAIAETWDNGKPIRETRAADLPLA
IDHFRYFAGVVRAQEGSIGEIDHDTIAYHFHEPLGVVGQIIPWNFPLLMACWKLAPALAA
GNCVVLKPAEQTPASIMVWAEIIADILPPGVLNIVNGFGVEAGKPLASSPRIAKIAFTGE
TSTGRLIMQYASQNLIPVTLELGGKSPNIFFNDVTAEDDDFFDKAIEGFVMFALNQGEVC
TCPSRALVHADIYDRFMERALKRVAAIKQGDPRDATTMIGAQASGEQLSKILSYIDIGKQ
EGAKVLAGGGRAELAGDLAGGFYVQPTVFEGHNKMRIFQEEIFGPVVSVTTFKTDEEALA
IANDTLYGLGAGVWSRDANRCYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGVGRETH
KMMLDHYQQTKNLLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggtggaattcctcagcgtcaccaaagttcccttcgcagagcgctatgacaat
ttcatcggcggcaagttcgtcgcgccgatctcgggcaagtatttcgacaatgcctcgccg
gtgaccggccaaatcgtctgcaagatcgcgcggtccgacgcgcaggacgtcgaggcggcc
ctcgacgcggcgcatgccgccaaggcggcctggggccgcaccagcgtcgccgagcgcgcc
gcggtcctgaaccggatcgccgaccgcatggaagagaacctcgagcgtctcgccatcgcc
gagacctgggacaacggcaagccgatccgcgagacccgcgccgccgacctgccgctggcc
atcgaccatttccgttatttcgccggcgtggtgcgcgcccaggaaggctcgatcggtgag
atcgaccacgataccatcgcctatcatttccatgagccgctcggcgtggtcggccagatc
attccctggaacttcccgctgctgatggcctgctggaagctcgcgcctgcgctcgccgcc
ggcaattgcgtggtgctcaagcccgccgagcagactccggcctcgatcatggtatgggcc
gagatcattgccgacatcctgccgccgggagtcctcaacatcgtcaacggtttcggcgtc
gaggccggcaagccgctcgcctcgagcccgcgcatcgccaagatcgccttcaccggcgag
acctcgacgggccggctgatcatgcaatatgccagccagaacctcattcccgtcacgctg
gagctcggcggcaagtcgccgaacatcttcttcaatgacgtcaccgccgaagacgacgat
ttcttcgacaaggcgatcgaaggtttcgtcatgttcgcgctgaaccagggcgaggtctgc
acctgtccgagccgggcgctggtgcacgccgatatctatgaccgcttcatggagcgtgcg
ctgaagcgcgtcgccgcgatcaagcagggcgatccgcgcgacgccaccaccatgatcggc
gcccaggcctctggcgagcagctctccaagattctctcctatatcgacatcggcaagcaa
gagggcgccaaggtcctggccggcggcggacgtgccgagctcgcgggtgatctcgccggc
ggcttctacgtgcagccgaccgtgttcgagggccacaacaagatgcggatcttccaggag
gagatcttcggtcccgtcgtttcggtcaccaccttcaagaccgacgaggaggcgctcgcg
atcgccaacgacacgctctacggcctgggcgccggcgtctggagccgtgatgccaatcgc
tgctaccgtttcggccgggagatccaggccggccgggtctggaccaactgttatcatgcc
tatcccgcgcatgctgccttcggcggctacaagcagtcgggcgtcggtcgcgagacccac
aagatgatgctcgatcactaccagcagaccaagaacctcctggtcagctacagcccgaag
aagctcggcttcttctga

DBGET integrated database retrieval system