KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_22160Help
Entry
BCCGELA001_22160  CDS       T04273                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Brite
KEGG Orthology (KO) [BR:brc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BCCGELA001_22160
Enzymes [BR:brc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     BCCGELA001_22160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Methyltransf_25 Rep_1B
Motif
Other DBs
NCBI-ProteinID: AMA58709
UniProt: A0A0X8CKK1
LinkDB All DBs
Position
4778477..4779508
Genome map
AA seq 343 aa AA seqDB search
MRAVVIHAPKDLRIDSYPDAAPAPGEARVRIANGGICGSDLHYYHHGGFGVVRIQQPMAL
GHEIAGVVADVGDGVTGVKPGTRVAVNPSRPCGQCLHCQQGMRNQCLDMRFLGSAMRFPH
VQGGFREFITVDATQAVPIADKLSLAEAAVAEPLAVCLHAGKQAGPLLGKRVLITGCGPI
GALMILVSRFGGAAEIVVTDVAEAPLAVARKLGASHAINVAANAAALDPWRTGKGVFDTL
FEASGNQAALRTALDVLRPGATLVQLGLGGDMTLPINTIVAKELQLRGTFRFDPEFELAV
RLMGEGLIDVKPLITATMPFENAVAAFELASDRSQSMKVQLTF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgtcgtcatccacgccccgaaggacctgcggatcgatagctatccggatgcg
gcgcccgccccgggcgaggcccgcgtcagaattgccaatggcggcatctgcggctctgac
ttgcattattaccatcacggcggcttcggcgtcgtgcgcatccagcagccgatggcgctg
ggccatgagatcgccggcgtggtcgctgacgtcggtgacggcgtcaccggcgtgaagccc
ggcacgcgcgtcgcggtcaatccgagcaggccgtgcggccagtgcctgcattgccagcag
ggcatgcgcaaccagtgcctcgacatgcgctttctcggcagcgcgatgcgctttccccat
gtgcagggcggtttccgcgagttcatcacggtcgatgcgacgcaggccgtgccgatcgcg
gacaagctgtcgctggcggaggccgcggtcgccgagccgctggctgtgtgcctgcatgcc
ggcaagcaggccggccctctgctcggcaagcgcgtgctgatcacgggctgcggcccgatc
ggggcgctgatgatcctggtctcacgcttcggcggcgccgccgagatcgtggtgaccgat
gtcgccgaagcgccgctcgcggtcgccagaaagctcggcgccagtcacgccatcaacgtc
gcggccaatgccgctgcgctcgatccctggcgcaccggcaagggcgtgttcgacacgctg
ttcgaagcctcgggcaatcaggcggccttgcgcaccgcgctcgatgtgctcaggcccggc
gccacgctggtgcagctcggccttggcggcgacatgacgttgccgatcaacaccattgtc
gccaaggaattgcagctccgcggcaccttccgcttcgatcccgagttcgagctggcggtg
cggctgatgggcgaaggcctgatcgacgtcaagccgctgatcacggccaccatgccgttc
gagaacgcggtcgccgccttcgagctcgccagcgaccgctcgcagtcgatgaaggtgcag
cttaccttctag

DBGET integrated database retrieval system