KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_27710Help
Entry
BCCGELA001_27710  CDS       T04273                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc00564  Glycerophospholipid metabolism
brc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BCCGELA001_27710
Enzymes [BR:brc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BCCGELA001_27710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AMA59673
UniProt: A0A0X8CM86
LinkDB All DBs
Position
complement(5938548..5940098)
Genome map
AA seq 516 aa AA seqDB search
MRLLERIYDLAIIGGGVNGCGIARDAVGRGNTVFLCEMNDLASGTSSWSTKLVHGGLRYL
EYYEFRLVREALIEREILWGIAPHIIRPLRFVLPHHAGLRPAWLLRLGLFLYDHIGGRHL
LPATRSVDLKRDEVGKPLIPNRYSRAFEYSDCFVDDARLVVLNARDAADKGAEIRTRTRA
TEIRQSNGVWTVGMVNTLTGERSQIQARALINAGGPWVEDVLGRGAGVNAKAKVRLVQGS
HIVVRKLYDHDRAYMFQNADGRIIFVIPYQDDFTLIGTTDRDYDGDPAKVKATPEEIQYL
CTAASEYLAKPVTPDDVVWTYSGVRPLYDDGASEAKAATRDYVFELDTPGGAPLLSIYGG
KITTYRRLAEEALERLAPYLRSAKAREGWTGKWPLPGGDMNVSDIDGLIAEFQRGYPFLS
HEHARRLARAYGTRAIKLLGDAKSAADLGQSFGATLTEREVRYLMANEWAVTAEDVVWRR
SKLGLRLSADEIAALDDWIRTHAVQQTPLLEAGGRS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgttggagcgtatttacgacctcgccatcatcggaggcggtgttaacggctgc
ggcatcgcgcgcgacgcggtgggccgcggcaacacggttttcctgtgcgaaatgaacgat
ctggcgagcgggacgtcgtcctggtcgaccaagctggtgcatggcggcctgcgctatctc
gaatattatgagttccgcctggttcgcgaggcgctgatcgagcgcgagatcctttggggc
atcgccccccacatcatccgtcccctgcgtttcgtcttgccgcatcacgccggcctgcgc
cccgcctggctgctgcgcctcggcctcttcctctatgaccacatcggcggccgccatctg
ctgcccgccacgcgctcggtcgatctcaagcgcgatgaggtcggcaagccgctgattccg
aatcgctacagccgcgcgttcgaatattccgactgtttcgtcgacgacgcccgcctcgtc
gtgctcaacgcccgcgatgccgccgacaagggcgccgagatccgcacccgcacccgcgcc
accgagatccgccagtccaacggcgtctggaccgtcggcatggtcaacacgctgaccggc
gagcgctcgcagatccaggcgcgcgcgctcatcaacgccggcggcccctgggtcgaggac
gtgctcggccgcggtgccggcgtcaacgccaaagccaaggttcgcctggtccagggctcg
cacatcgtggtcaggaagctctacgaccacgaccgcgcctatatgttccagaacgccgac
ggccgcatcatcttcgtcatcccgtaccaggacgacttcaccctgatcggcaccaccgac
cgcgactatgacggcgaccccgccaaggtgaaggcgacacccgaggagatccaatatctc
tgcaccgcggcgagcgagtatctggccaagcccgtgacgccggacgacgtggtctggacc
tattccggcgtgcgtccgctctatgatgacggcgccagcgaagccaaagctgcgacccgc
gactatgtgttcgagctcgacacgcccggcggcgcgccgctgctgtcaatctatggcggc
aagatcaccacctatcgccgccttgccgaagaggcgctggagcggctcgcgccgtatctg
cgcagcgcaaaggcgcgcgagggctggaccggcaaatggccgctgcccggtggtgacatg
aacgtctccgacatcgacgggctgatcgccgagttccagcgcggctatcccttcctcagc
cacgagcatgcgcgacgcctcgcccgtgcctatgggacacgggcgatcaagctgctgggc
gatgccaaatcggcggccgatctcggccagtcgtttggggcgacgctgaccgagcgcgag
gttcgctacctcatggccaacgaatgggccgtcaccgccgaggacgtggtctggcgccgg
tccaagctcggcctgcgactatctgccgacgagatcgcagcgcttgacgactggatcagg
acccatgccgtgcagcaaactcccctgctggaagcaggaggacgctcatga

DBGET integrated database retrieval system