KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_29405Help
Entry
BCCGELA001_29405  CDS       T04273                                 

Gene name
oppD
Definition
(GenBank) oligopeptide transporter ATP-binding component
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:brc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BCCGELA001_29405 (oppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brc02000]
    BCCGELA001_29405 (oppD)
Transporters [BR:brc02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BCCGELA001_29405 (oppD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 AAA_22 AAA_7
Motif
Other DBs
NCBI-ProteinID: AMA59962
UniProt: A0A0X8CSA1
LinkDB All DBs
Position
complement(6390236..6391222)
Genome map
AA seq 328 aa AA seqDB search
MEPLLQIADLRVTFDDVPTLRGIDLTLARGESLGMVGESGCGKSVTWLAALGLLTGRANI
TGSVRLAGDELLDATASRLDKVRGGRIAMIFQDPASALNPVHRVGDQIIEVLRLHRGMDQ
RAALAEARRLLDQVGIPDAARRLRAYPHEFSGGQNQRIMIAMALAGQPDILIADEPTTAL
DVSIQAQILELLRQIQRETGMALVLISHDLGVVSEICERVMVLYGGHIVEELPADRLFAR
PAHPYTRGLLAALPSLDGPRQRLFAIPGVVPNAAAFPPGCPFAPRCDRRIGGCRDWAMEL
AALEGDIRHRAACLHVTSEPPAGEVVAA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggagccgcttcttcaaatcgcagatttgcgtgtcacgttcgatgatgtgccgacgctg
cgcggaatcgatctcacgctcgcgcgcggcgagtcgctgggcatggtcggggaaagcggt
tgcggtaaatctgtgacatggcttgcggcgctcggactgttgaccggacgcgcgaacata
acgggcagcgtacgcctggccggagacgagctgctcgatgcaacagcctctcggctcgac
aaggtgcggggcgggcggatcgccatgatcttccaggacccggcgagcgcgcttaatccc
gtgcacagggtgggcgatcagatcatagaggtcttgcggctccatcgtggcatggatcag
cgcgcggcgcttgccgaagcccgtcgtctgctcgaccaggtcggcatacccgatgcagcc
cgccggcttcgcgcctatccgcacgaattctccggtggccagaaccagcgcatcatgatc
gccatggcgcttgcaggacagcccgacatcttgatcgccgacgaaccgaccaccgccttg
gatgtcagcattcaagcgcagattcttgagcttctgcggcaaattcagcgcgagacaggc
atggcactggtcctgatctcgcatgatctcggcgtcgtcagcgagatctgtgaacgtgtc
atggtgctttacgggggccacatcgtcgaagaattgcccgctgaccgtctcttcgcgcga
cctgctcacccatatacgagaggtcttcttgcggctcttccaagtctggatgggccccgg
caacgcctcttcgccattcccggtgtcgtgccaaacgcagccgcgtttcccccgggctgt
ccgttcgcccctcgatgcgatcggcggatcggaggctgtcgtgattgggcgatggagctc
gccgcgctggagggcgacatcagacacagggccgcctgcttgcatgtcacgagcgaaccg
cccgcgggcgaggtcgtggccgcatga

DBGET integrated database retrieval system