KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_33075Help
Entry
BCCGELA001_33075  CDS       T04273                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:brc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BCCGELA001_33075
Enzymes [BR:brc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BCCGELA001_33075
Transporters [BR:brc02000]
 Other Transporters
  Pores ion channels [TC:1]
   BCCGELA001_33075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AMA61644
UniProt: A0A109Q6L0
LinkDB All DBs
Position
complement(7287058..7287696)
Genome map
AA seq 212 aa AA seqDB search
MTDRITLYYSPQSRATGTRVLLEELGAPYDLHVLNMKAGEQRQPAYLAINPLGKVPAVRY
GEALVTEQVAITIYLADLFPQAGLTPALNDPLRGPYLRWIAYYGSSFEPAMIDKFMQREP
APITQSPYADYDTMLGALEAQLSKGPYLLGERMTAADVLWGVALSWTMMFGIVPKKDVFV
RYAERMTSRPAFQRINAADDEMAAQHAKAVGG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgcatcacgctgtattactcgccgcagagccgggccacaggcacgcgggtg
ctgctggaggagctgggcgcgccttacgatctgcacgtcctcaacatgaaggccggcgag
cagcgccagcccgcctatctcgccatcaatccgctcggcaaggtgccggcggtccgctac
ggcgaagcgctggtgaccgagcaggttgcgatcaccatctatcttgccgatctgtttccg
caggccgggctgacgcccgccctgaacgatccgctgcgcgggccttatctgcgctggatc
gcctattacggctcgtcgttcgagccggccatgatcgacaagttcatgcagcgcgagccg
gcgccaatcacgcaatcgccctatgccgattacgacaccatgctgggcgcgctcgaggcg
cagctgtcgaaagggccgtacctactcggcgagcgcatgaccgcagcagacgtgctctgg
ggcgtggcgctcagctggaccatgatgttcggcatcgtgccgaagaaggacgtcttcgtc
cgttatgccgagcgcatgacctcgcggcctgcgttccagcgcatcaatgcggccgatgat
gagatggccgcacagcatgccaaggcggttgggggatag

DBGET integrated database retrieval system