KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_33925Help
Entry
BCCGELA001_33925  CDS       T04273                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc03030  DNA replication
brc03410  Base excision repair
brc03420  Nucleotide excision repair
brc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:brc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BCCGELA001_33925
   03410 Base excision repair
    BCCGELA001_33925
   03420 Nucleotide excision repair
    BCCGELA001_33925
   03430 Mismatch repair
    BCCGELA001_33925
Enzymes [BR:brc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BCCGELA001_33925
    6.5.1.6  DNA ligase (ATP or NAD+)
     BCCGELA001_33925
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BCCGELA001_33925
DNA replication proteins [BR:brc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BCCGELA001_33925
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BCCGELA001_33925
DNA repair and recombination proteins [BR:brc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BCCGELA001_33925
   NER (nucleotide excision repair)
    Other NER factors
     BCCGELA001_33925
   MMR (mismatch exicision repair)
    Other MMR factors
     BCCGELA001_33925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N
Motif
Other DBs
NCBI-ProteinID: AMA60718
UniProt: A0A0X8CNJ7
LinkDB All DBs
Position
7508946..7510607
Genome map
AA seq 553 aa AA seqDB search
MNRFAELLDRLAYEPGRNNKLRLITGYFREVADPDRGYALAALTGALSFKHAKPALIRDL
IAARTDEVLFGLSYDYVGDLSETVALMWPKAPLAAHNNPPPPSLTEVVTTLRTLGKTELP
KQLERWLDELDETGRWALLKLVTGALRIGISARLAKTAAAALGDKDPHEVELIWPGLAPP
YLDLFAWLEGRGDKPVNRDPAPFRPVMLAHAIEDTDFASLDPADYIAEWKWDGIRVQAVA
GRDERGHITARLYSRTGEDITGSFPDLVPSLRLPGAIDGELLILREGRVQSFNVLQQRLN
RKVVSPKLIKEFPIHLRAYDLLGDDQNDLRELPFAERRERLETFIAKLDDPRIDLSTTVP
FASWEALTAARADPASAGAGEDADAVEGVMLKRRDAPYLPGRPKGQWWKWKRDPHIIDAV
LMYAQRGHGKRSSYYSDYTFGVWTGGDGGDELVPVGKAYFGFTDEELLQIDRFVRRNTTE
KFGPVRHVVHEPDKGLVLEVAFEGLQRSPRHKSGVAMRFPRISRLRWDKPPREADRLETL
ERMLKAEPAEVEM
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcttcgccgagctgctcgatcgcctcgcctacgagcccggccgcaacaacaag
ctgcggctgatcaccggctatttccgcgaggtcgccgaccccgatcgcggctacgcattg
gccgcgctcaccggcgcactcagcttcaagcatgccaagcccgcattgatccgcgacctc
atcgcggcgcgcacggatgaggtgctgttcgggctatcctacgactatgtcggcgatctc
tcggagacggtggcgctgatgtggccgaaggcgccgttggccgcccataacaacccgccg
cctccgtccctcaccgaagtcgtcaccacgctgcgtacgctcggcaagaccgagctgcca
aagcagctcgaacgctggctcgacgagctcgacgagaccggccgctgggcgctgctgaag
ctcgtgaccggcgcgcttcgcatcggcatttccgcgcgccttgccaagactgctgccgca
gcattgggcgacaaggacccgcatgaggttgagctgatctggccggggcttgcgccgcct
tatctcgacctgttcgcctggctcgaaggccgcggcgacaagccggtcaatcgcgatccc
gcgccgttccgcccggtgatgctcgcgcatgcgatcgaggacacggatttcgcttcgctc
gatcccgccgactatatcgccgaatggaaatgggacggcattcgcgtgcaggcggtggca
ggccgcgatgagcgcgggcacattaccgcgcggctctattcgcgcaccggcgaagacatc
accggcagctttccggatctcgtgccgtcgctgcgcctgcctggcgccatcgacggcgag
ctcctgatcctgcgcgagggtcgcgtgcagagcttcaacgtgctgcaacagcgtctcaac
cgcaaggtggtctcgccaaagctgatcaaggaatttccgatccatctgcgcgcctacgac
ctgctcggcgacgaccagaacgacctgcgcgagctgccgttcgcggagcggcgcgagagg
ctcgagaccttcatcgcaaagctcgacgatccccgcatcgacctgtcgaccaccgtgccc
ttcgcaagctgggaggcgctgaccgccgcgcgcgccgatcccgccagtgccggcgccggc
gaggacgccgacgcggtcgaaggcgtgatgctgaagcggcgcgatgcgccgtatttgccg
gggcggccgaaggggcaatggtggaagtggaaacgcgacccgcacatcatcgacgccgtg
ctgatgtatgcgcagcgcggccacggcaagcgctcgtcctattattccgactacaccttc
ggcgtctggaccggcggcgatggcggcgacgagctggtgccggtcggcaaagcctatttc
ggcttcaccgacgaggagctgttgcagatcgaccgcttcgtccgccgcaacaccaccgaa
aagttcggccctgtccgccatgtcgtgcacgagccggacaagggtctcgtgctggaggtc
gcgttcgaggggctgcagcgctcgccgcggcacaaatccggcgtcgccatgcgctttccc
cgcatcagccgcctgcgctgggacaagccgccgcgggaagcggacaggctggaaacgctg
gagcggatgctgaaggcggagccggcggaggtggagatgtga

DBGET integrated database retrieval system