KEGG   Brevundimonas sp. DS20: JL11_01200Help
Entry
JL11_01200        CDS       T04101                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
brd  Brevundimonas sp. DS20
Pathway
brd00620  Pyruvate metabolism
brd00680  Methane metabolism
brd01100  Metabolic pathways
brd01120  Microbial metabolism in diverse environments
brd01200  Carbon metabolism
Module
brd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:brd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JL11_01200
  09102 Energy metabolism
   00680 Methane metabolism
    JL11_01200
Enzymes [BR:brd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     JL11_01200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ALJ09889
UniProt: A0A0P0DJQ9
LinkDB All DBs
Position
245183..247879
Genome map
AA seq 898 aa AA seqDB search
MSPAADDALREEVRLLGGLLGEVIRAEGGEALFEHVEAVRQASVAYHRDPASHPAKRLEK
LLTAMSVDQAAGLAHGFALFSLLANIAEDRATRRRAQHQAEAGARPDTPEGALLRLADQK
IDKAAVRALLDEALISPVLTAHPSEVRRKSVIDRITAISDLLDSCDKAGDACSTAQINEP
LRRQIVILWATRLVRTQGLVVQDEIDTVVSFLDRIFLRVAPKQLSAWRRLLDAPQLQPFL
RVGTWVGGDRDGNPNVDGAVLSAAFRTQARAVLGFYLEEVHALGAELSLAAELAEVSPEL
AALADAAQDPSPHRADEPYRRALTGVYARLAATYEARGGALPPRRAAVAAEAYAGPDAFE
ADLRILRDSLVSHHGEVFADDRLNDLITAVEIFGFHMATLDLRQNSDVHERVVADLLKTA
GVCDDYSALDEEGRLAVLAAELTSPRLLFSPYADYAAETLKERAILQAAADALAAFGPQA
IRTHIVSKTDAASDLLEVYLLLKEVGLYRPEDPAACPIQAAPLFETIEDLRASRPTLERL
LKEPSALAVAKARGVQEVMIGYSDSNKDGSYLTSGWELHEASRALVEVTQAAGLKLQLFH
GRGGTVGRGGGSAFAGVLAQPEGTVQGRIRTTEQGEVIANKYGEPEIALRNLDALTCGAV
LASLGQGRDQAFTAEHGATLSDLSARSMAAYRKLVYETDGFVDYYRAATPIAEIADLKIG
SRPSSRTASTRIEDLRAIPWVFSWSQSRVMLPGWFGFGSAVQGCDMGELKAMAEAWPFFR
TLVQNMEMVMAKSDMTVARRYATLVSDASLAARIYGEIRDEWQRTHDAILAITGHDKLLG
GQPELDRLIRLRMPYVEPLNHVQIELIRRRRAGDEDPRVREGILLAINGVAAGLRNSG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgagccctgccgccgacgacgccctgcgcgaagaagtccgactgctgggcgggcttctg
ggcgaggtcattcgcgccgaaggcggagaggccctgttcgaacacgtcgaggccgtgcgc
caggcctccgtcgcctatcaccgcgaccccgcctcccatccggccaagcggctggagaag
ctgctgaccgccatgagcgtggatcaggcggcgggtctggcgcacggtttcgccctcttt
tccctgctcgccaacatcgccgaggaccgggccacccgccgacgcgcccagcaccaggcc
gaggccggcgcgcgtcccgacacgcccgagggcgccttgctgcggctggccgatcagaag
atcgacaaggcggcggtgcgcgccctgctggacgaggccctgatctcgccggtcctgacc
gcccacccgtccgaggtgcggcgcaagagcgtcatcgaccggatcaccgccatctccgat
ctgctggattcctgcgacaaggccggcgacgcctgttcgacggcccagatcaacgaaccc
ctgcgccgccagatcgtcatcctgtgggccacccgcctggtgcgcacccagggtctggtg
gtgcaggacgagatcgacaccgtcgtctccttcctggaccgcatcttcctgcgggtcgcg
ccgaaacagctgtcggcctggcgtcgtctgctggacgcgccccagcttcagcccttcctg
cgggtgggcacctgggtcgggggcgaccgggacggcaatccgaacgtggacggcgcggtg
ctgagcgccgccttccgcacccaggcgcgggcggtcctaggcttctatctggaagaggtc
cacgccctcggcgccgagctcagcctggcggcggaactggccgaggtctcgccggaactg
gcggccctggccgacgccgcccaggacccgtcgccgcaccgggcggacgagccctatcgc
cgcgccctgaccggggtctatgcgcgtctggccgccacctatgaggcgcggggcggcgcc
ctgcccccgcgccgcgcggccgtcgcggccgaagcctatgccggccccgacgccttcgag
gccgatctgcgaatcctgcgcgacagcctggtctcgcaccacggcgaggtgttcgccgac
gaccggctgaacgatctgatcacggcggtcgaaatcttcggcttccacatggcgaccctg
gacctgcgccagaactcggacgtccatgagcgggtcgtcgccgacctgctgaagacggcc
ggggtctgcgacgactattccgccctggacgaagaggggcggctcgccgtcctggcggcc
gaactgacctcgccccgcctgctgttcagcccctatgccgactacgccgccgagaccctg
aaggagcgggccatcctccaggccgccgccgacgccctggccgccttcggcccccaggcg
atccgcacccatatcgtctccaagaccgacgcggcctcggacctcttggaggtctatctg
ctgctgaaggaggtcgggctttaccgccccgaagaccccgccgcctgcccgatccaggcg
gcgcccctgttcgagaccatcgaggacctgcgcgcctcccgccccaccctggagcggctg
ctgaaggaaccctccgccctggccgtggccaaggcgcgcggggtgcaggaggtgatgatc
ggctattccgactccaacaaggacggctcctatctgacttcgggctgggagctgcacgag
gcctcgcgcgcccttgtcgaggtcacccaggccgccggtctgaagctgcagctgttccac
gggcgcggcggcacggtcggacgcggcggcggctcggccttcgctggggtcctggcccag
ccggagggcacggtccagggccggatccgcacgaccgaacagggcgaagtcatcgccaac
aaatacggcgagccggagatcgccctgcgcaatctggacgccctgacctgcggcgccgtg
ctggcctccctgggccagggacgggaccaggccttcaccgccgaacacggcgccaccctg
tcggacctgtcggcccggtcgatggccgcctatcgcaagctggtctatgagaccgacggc
ttcgtcgactattaccgcgccgccacccccatcgccgagatcgccgacctgaagatcggt
tcgcgcccgtcgtcgcggaccgcctcgacccggatcgaggatctgcgcgccattccgtgg
gtgttcagctggtcccagagccgggtcatgctgcccggctggttcggcttcggctcggcg
gtgcagggctgcgacatgggcgagttgaaggcgatggccgaggcctggcccttcttccgc
accctggtgcagaatatggagatggtcatggccaagtcggacatgaccgtcgcccgccgc
tacgccaccctggtcagcgacgcctcgctggccgcccgcatctatggcgagatccgcgac
gaatggcagaggacgcacgacgccatcctggccatcaccggccatgacaagctgctgggc
ggccagccggaactggaccgtctgatccgcctgcggatgccctatgtcgagccgctgaac
cacgtccagatcgagctgatccgtcgccgtcgcgccggggacgaagacccccgcgtccgc
gaaggcatattgctggccatcaacggcgtggctgcgggtctgaggaacagcggctga

DBGET integrated database retrieval system