KEGG   Brevundimonas sp. DS20: JL11_06410Help
Entry
JL11_06410        CDS       T04101                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
brd  Brevundimonas sp. DS20
Pathway
brd00500  Starch and sucrose metabolism
brd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    JL11_06410
Enzymes [BR:brd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     JL11_06410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ALJ08011
UniProt: A0A0P0CYN4
LinkDB All DBs
Position
complement(1317389..1319761)
Genome map
AA seq 790 aa AA seqDB search
MRHFRSFCLAGAAGLALASAASAQSGIAPGAPGDPPTWSSAAKTGAGASYEAYVDGQYRD
GGPTGAVSKVWFSIADGVLTETMYGLIHEAQIKALRFAVVTPDGLAVEGADTTEQTEYLH
TDAQGRPLSPAYRVTTRDKAGRFEIEKRIFTDPDRNALVLRVKITALSGEATPYLLLEPH
IANTGVDDRGQVTRQAFHAWEGDTHLVLKPSRPFDKAGVGFVGASDGLTDLKDGRMDWTY
ASTGETAGNTMMTGALPRLRQGQSLTRDFVIGFGSSEAQAQAAADGAFATGLDEVLARFN
GESDRIGWEDYVASLTELPRIAEQATDGGKLAYASALMLKVQEDRTHAGALIASLSNPWG
DTVDASKSSTGYKAVWPRDFYQVAMALAALGDKETPLAAFNYLPQVQVGPDTPGNTGVGG
WFLQKTHVDGELEWVAVQLDQTAMPIMLGYRLWKLGWLSDAQMADHYRSMLKPAADFLVD
GGKIGLLWNDAEIKPPFTQQERWEEQQGYSPSTTAAVVAGLTVAAEMARASGDAAGATRY
QLAADSYASKIEERMFTTSGDFGDGRYFIRITRNENPNDKAPIGAANGQIAPQEDRVVDG
GFLELVRYGVRKADDPHIVSTLPVYDDQSLEDLYRVRYDFGPEGDQTPGWRRYGVDGYGE
DHVTGANYGVGGQMSPGQRGRVWPFFTGERGHYELARVSLNGAPSAADIAAIRQTYVRGM
ERFANDGLMLAEQVWDGVGEPTARDYALGQNTDSATPLAWTHAEYLKLLRSLADGKVWDR
YEPVESRYAR
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcacttccgttccttctgcctcgccggcgccgccggcctggcgctcgcctcggcc
gcctcggcccagtccgggatcgctccgggcgcgccgggtgatccgcctacctggtccagc
gccgccaagaccggcgccggggcctcctatgaagcctatgtcgacggccagtaccgtgac
ggcggcccgaccggcgcggtgtcgaaggtctggttctccatcgccgacggcgttctgacc
gaaaccatgtacggcctgatccacgaggcccagatcaaggcgcttcgcttcgccgtcgtc
acccctgacggcctggctgtggagggcgccgacaccaccgagcagaccgaatatctgcat
acggacgcccagggccgccccctgtcgccggcctatagggtcaccacgcgcgacaaggcc
ggccggttcgaaatcgagaaacgcatcttcaccgacccggaccgcaacgccctggtgctg
cgggtcaagatcacggccctgagcggagaggccacgccctatctgctgctggagccgcac
atcgccaacaccggcgtcgacgaccggggtcaggtcacgcgccaggccttccatgcctgg
gaaggcgacacccatctggtgctcaagccgagccgtccgttcgacaaggccggcgtcggc
ttcgtcggcgcctcggacggtctgaccgacctgaaggacggccggatggactggacctac
gcctccaccggtgagacggcgggcaatacgatgatgacgggcgccctgccgcgcctgcgt
caggggcagagcctgacccgcgatttcgtgatcggcttcggctccagcgaggcccaggcc
caggcggcggcggacggcgcctttgcgaccggcctggacgaggtcctggcccggttcaac
ggcgagagtgatcgcatcggctgggaggactatgtcgcctccctgaccgaactgccgcgc
atcgccgaacaggcgacggacggcggcaagctggcctacgcctcggccctgatgctgaag
gtgcaggaggaccgcacccatgccggcgccctgatcgcctccctgtccaacccctggggc
gacacggtggacgcatcgaaatcttcgacaggctacaaggccgtctggccgcgcgacttc
tatcaggtagccatggccctggcggcgctgggcgacaaggagacgccgctggcggccttc
aactatctgccccaggtccaggtcggcccggacacgcccggcaataccggcgtcggcggc
tggttcctgcagaagacccatgtggacggagaactggaatgggtcgcggtccagctggac
cagacggccatgccgatcatgctgggctatcgtctgtggaagctgggctggctgtccgac
gcccagatggccgaccactatcgttcgatgctgaagccggcggccgacttcctggtggac
ggcggcaagatcggccttctgtggaacgacgccgagatcaagccgcccttcacccagcag
gagcgctgggaggagcagcagggctattccccctccaccaccgccgccgtggtggccggg
ctgacggtcgcggccgaaatggcgcgcgcctcgggcgatgcggcgggagcgacccgctat
cagctcgccgccgacagctacgcctccaagatcgaagagcggatgttcacgaccagcggc
gacttcggcgacggccgctatttcatccgcatcactcggaacgagaacccgaacgacaag
gccccgatcggcgccgccaacggccagatcgcgccccaggaggaccgggtcgtggacggc
ggcttcctggaactggtccgctacggggtgcgcaaggccgacgatccgcacatcgtttcg
accctgcccgtctatgacgatcagagcctggaggacctgtaccgggtccgctacgacttc
gggccggagggcgaccagacgccgggctggcgccgctacggcgtcgacggctatggcgag
gatcatgtcacgggcgccaactatggcgtcggcgggcagatgagccctggtcagcggggt
cgggtctggcccttcttcaccggcgagcgcggccactatgagctggcccgcgtcagcctg
aacggcgctccgtccgccgccgacatcgccgccatccgccagacctatgtgcgcggcatg
gagcggttcgccaatgacgggctgatgctggccgaacaggtctgggacggggtcggcgag
ccgaccgcgcgcgactacgccctgggccagaacaccgactcggccacgcccctggcctgg
acccatgccgaatatctgaagctgctgcggtccttggccgacggcaaggtgtgggatcgg
tacgagccggtcgaaagccgctacgcccgctga

DBGET integrated database retrieval system