KEGG   Brevundimonas sp. DS20: JL11_07105Help
Entry
JL11_07105        CDS       T04101                                 

Definition
(GenBank) MarR family transcriptional regulator
Organism
brd  Brevundimonas sp. DS20
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_24 HTH_5 FeoC TrmB HTH_IclR Fe_dep_repress HTH_29 HTH_34 DprA_WH Penicillinase_R PadR
Motif
Other DBs
NCBI-ProteinID: ALJ08127
UniProt: A0A0P0DB32
LinkDB All DBs
Position
complement(1492539..1492988)
Genome map
AA seq 149 aa AA seqDB search
MTSLVRSVRRIAQAIDVRSREVARLTGLTLPQLLVLQSIRDLGEVSTSAISRDVSMSPPT
VVAVLDKLEAKGMAVRYRSTIDRRIVHVRLTEAGRDALASSPGLFGDGFISGFGRLSADD
RAAMATAVDRLATMMQPRPPAFSEDGERG
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctctggtgcgctccgtccggcgaatcgcccaggcgattgacgtccgatcgcgg
gaagtcgcgcgcctgacgggcctgaccctgccccaacttctggtgctgcagtcgatccgc
gacctgggcgaggtcagcaccagcgccatatcccgcgacgtctccatgtcgccgcccacg
gtggtcgccgtgttggacaagctggaagccaaggggatggccgtgcgttaccgctcaacg
attgaccgtcggatcgtccatgtccggctgacagaggccgggcgggacgccctcgcctcc
tcgcccggcctgttcggcgacggcttcatttcaggtttcggccgattgtcggcggacgac
agggcggcgatggcgacggctgtggatcggctggcgactatgatgcagccgcgcccgcct
gcgttttcagaagacggcgaaaggggctga

DBGET integrated database retrieval system