KEGG   Brevundimonas sp. DS20: JL11_10420Help
Entry
JL11_10420        CDS       T04101                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
brd  Brevundimonas sp. DS20
Brite
KEGG Orthology (KO) [BR:brd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JL11_10420
Enzymes [BR:brd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     JL11_10420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 FAD_binding_3 HI0933_like AlaDh_PNT_C NAD_binding_7 Thi4 NAD_binding_8 Glutaredoxin DAO FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ALJ08712
UniProt: A0A0P0DH01
LinkDB All DBs
Position
2139676..2141262
Genome map
AA seq 528 aa AA seqDB search
MLDANLKSQLESYLKNIVHPVELIASLGAGPKSQELKTLLEEIVSVSHGKVEMGRDYDDE
RQPSFLIRRKGTDIGVRFAGIPLGHEFTSLVLALLHVGGHPSKAAQEVIQQVKDLEGDYV
FETYFSLSCQNCPDVVQALNLMSVLNPRIKHVAIEGGLFKDEVDERKIMAVPTVFLNGEL
FGQGRMELEQIVAKLDSGAEARAAERLKAKDPFDVLVVGGGPAGAAAAIYTARKGIRTGI
VAERFGGQVLDTMAIENFISVPHTEGPKLAAHLEQHVREYEVDLMNLQKAAKLIPAKVPG
GLHEVVLENGASLKSRTVILSTGARWRQMNVPGEDQYKNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVAHVTLIEYDSELRADAVLQRKLATLPNVRIVTSALTTEVRGD
GEKVTGLVYKDRNSDAHHDVDLEGVFVQIGLVPNTEWLHGAVALTTRGEIEVDHRGETSQ
PGVFGAGDVTTVPYKQIVVAMGEGSKAGLAAFDYMIRTVPAEEAVEAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatctgaaatctcagctcgagagctacctcaagaacatcgtccatccg
gtcgaactgatcgcgtcgctgggcgcggggcccaagtcgcaggagctgaagaccctgctg
gaggagatcgtctcggtctcgcacggcaaggtcgagatgggccgcgactatgacgacgaa
cgccagcccagcttcctgatccgcaggaagggcaccgacatcggggtgcggttcgcgggg
attcctctgggccacgagttcacctcgctggtgctggccctgctgcacgtcggcggccat
ccgtccaaggcggcgcaggaggtgatccagcaggtcaaggatctggagggcgactatgtg
ttcgagacctatttctcgctgtcgtgccagaactgccccgacgtggtgcaggccctgaac
ctgatgagcgtgctgaacccgcgcatcaaacacgtcgccatcgaaggcggcctgttcaag
gacgaggtggacgagcgcaagatcatggccgtgccgacggtcttcctgaacggcgaactg
ttcggccagggccggatggagctggagcagatcgtcgccaagttggattcgggcgccgag
gcgcgggccgccgagcggctgaaggccaaggacccgttcgacgtgctggtggtcggcggc
ggaccggccggggcggcggccgccatctatacggcgcgcaagggcatccgcaccggcatc
gtggccgaacggttcggcggccaggtgctggacaccatggcgatcgagaacttcatctcg
gtgccccataccgaggggccgaaactggccgcccatctggagcagcatgtccgcgaatat
gaggtggacctgatgaacctgcagaaggcggccaagctgatcccggccaaggttccgggc
ggtctgcacgaggtggtgctggagaacggcgccagtctgaagtcgcgcaccgtcatcctg
tcgaccggcgcccgctggcgccagatgaacgtgccgggcgaggaccagtacaagaacaag
ggtgtggcctattgcccgcactgcgacgggccgctgttcaagggcaagcgggtggcggtg
atcggcggcggaaactccggcgtcgaggcggccatagacctggcgggcatcgtggcccat
gtgaccctgatcgaatacgacagcgagctgcgggccgatgcggtgctgcagaggaagctg
gcgaccctgccgaacgtgcggatcgtcacctcggccctgacgaccgaggtgcgcggcgac
ggcgagaaggtgacgggcctggtctacaaggaccgcaactccgacgcccatcacgacgtc
gatctggaaggcgtcttcgtccagatcggcctggtgccgaacaccgaatggctgcacggc
gccgtcgccctgacgacgcgcggcgagatcgaagtggatcaccggggcgagacgtctcag
ccaggcgtcttcggggcgggcgacgtgacgaccgtgccctataagcagatcgtggtggcg
atgggtgagggctccaaggcagggctggccgccttcgactatatgatccgcaccgtcccg
gccgaagaggcggtcgaggcggcctga

DBGET integrated database retrieval system