KEGG   Brevundimonas sp. DS20: JL11_13510Help
Entry
JL11_13510        CDS       T04101                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
brd  Brevundimonas sp. DS20
Pathway
brd00970  Aminoacyl-tRNA biosynthesis
brd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    JL11_13510 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:brd03029]
    JL11_13510 (gatB)
Enzymes [BR:brd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     JL11_13510 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     JL11_13510 (gatB)
Mitochondrial biogenesis [BR:brd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    JL11_13510 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF2014 YqeY
Motif
Other DBs
NCBI-ProteinID: ALJ09236
UniProt: A0A0N7HZW9
LinkDB All DBs
Position
complement(2748952..2750454)
Genome map
AA seq 500 aa AA seqDB search
MTDTVPNPKTIKGRTGDWEIVMGLEIHAQVASKAKLFSGAAVGFGAGPNEQVSLVDAGFP
GMLPTLNKHCVEQAVKTGLGLRAQINKRSQFDRKNYFYPDLPTGYQISQLYYPIVGEGVV
EVEAEDGSFFNVGIERLHLEQDAGKLIHDLSPTESYVDLNRAGTALMEIVSRPDLRTPEE
AVAYVKKIRTILVYLGTCDGDMEKGNLRADVNVSVCRAGNYEKFKATGDFSFLGTRCEIK
NVNSFRFISQAIQYEARRQIEILEDGGSIIQETRLFDPVKGETRSMRSKEEAQDYRYFPD
PDLLPLDLEEAWIAEIKASLPELPDDKRKRLMSQYGLSQYDAIVLISEQAKADYFEAAAQ
GRDAKLVANWVTNEVSARLAADGKDFSENPLPAAHVAQLVELIETNVISSKIAKEVFDHV
WNGEGSPAEVVEKHGLKQVTDTGAIEKAIDEIIAANPDKAAAVAEKPQALGWFVGQVMKA
TGGKANPAAVNDILKAKLGL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacactgttccgaacccgaaaaccatcaagggccgcaccggcgattgggaaatc
gtcatggggctggagatccacgcccaggtggcctccaaggccaagctcttctccggcgcc
gccgtcggcttcggcgcggggccgaacgaacaggtctcgctggtggacgccggcttcccc
ggcatgctgccgaccctgaacaagcactgcgtcgaacaggcggtgaagaccggtctgggc
ctgcgtgcgcagatcaacaagcgcagccagttcgaccgcaagaactacttctaccccgac
ctgccgacgggctatcagatcagccagctctattaccccatcgtcggcgaaggcgtggtc
gaggtggaggccgaggacggcagcttcttcaacgtcggcatcgagcggctgcaccttgag
caggatgcgggcaagctgatccacgacctgtcgccgaccgagagctatgtcgacctgaac
cgggccggcacggccctgatggagatcgtctcgcggcctgacctgcgcacgccggaagag
gcggtcgcctacgtcaagaagatccggaccatcctggtctatctaggcacctgcgacggc
gacatggagaagggcaacctccgcgccgacgtgaacgtctcggtctgccgcgccggcaac
tatgagaagttcaaggccacgggcgacttcagcttcctgggcacgcgctgcgagatcaag
aacgtcaactcgttccgcttcatctcccaggcgatccagtacgaggcgcgccgccagatc
gagatcctcgaggacggcggttcgatcattcaggaaacccgcctgttcgatccggtgaag
ggcgaaacgcggtcgatgcgctccaaggaagaggcgcaggactaccgctacttccccgac
cccgacctgctgccgctggacctggaagaggcctggatcgccgagatcaaggcgtctctg
cccgaactgccggacgacaagcgcaaacgtctgatgagccagtacggcctgtcccagtac
gacgccatcgtgctgatctcggaacaggccaaggccgactatttcgaggccgccgctcag
ggtcgcgacgccaagctggtcgccaactgggtgacgaacgaggtgtcggcgcgtctggcc
gccgacggcaaggacttcagcgagaacccgctgccggccgcccatgtggcccagctggtc
gaactgatcgagaccaacgtcatctcctccaagatcgccaaggaggtgttcgaccacgtc
tggaacggcgaaggctcgccggccgaggtggtggagaagcacggcctgaagcaggtgacc
gacaccggcgccatcgagaaggcgatcgacgagatcatcgccgccaatccggacaaggcc
gccgccgtcgccgagaagccacaggccctcggctggttcgtcggccaagtcatgaaggcc
acgggcggcaaggccaatccggccgccgtcaacgacatactgaaggccaagctggggctt
tga

DBGET integrated database retrieval system