KEGG   Brevundimonas sp. GW460-12-10-14-LB2: A4249_04550Help
Entry
A4249_04550       CDS       T04395                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
brg  Brevundimonas sp. GW460-12-10-14-LB2
Brite
KEGG Orthology (KO) [BR:brg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A4249_04550
Enzymes [BR:brg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A4249_04550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 FAD_binding_3 AlaDh_PNT_C NAD_binding_7 NAD_binding_8 Glutaredoxin HI0933_like Thi4 FMO-like DAO K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ANC52992
UniProt: A0A160HY28
LinkDB All DBs
Position
943703..945292
Genome map
AA seq 529 aa AA seqDB search
MLDANLKSQLEAYLKNIVHPVELVASLGAGPKSIELKTLLEEIVSVSHGKVEMGRDYDDE
RQPSFLIRRKGTDIGVRFAGIPLGHEFTSLVLALLHVGGHPSKAAQEVIQQVKDLDGDYV
FETYFSLSCQNCPDVVQALNLMSVINPRIKHVAIEGGLFKDEVEERKIMAVPTVFLNGEL
FGQGRMELEQIVAKLDSGAEARAAERLKSKDPFEVLVVGGGPAGAAAAIYTARKGIRTGV
VAERFGGQVLDTMAIENFVSVPYTEGPKLAAHLEQHVREYEVDLMNLQKAAKLIPAKVPG
GLHEVVLDNGASLKSRTVILSTGARWRQMNVPGEEQYKNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVAHVTLIEYDSELRADAVLQRKLATLPNVRIVTSALTTQVHGD
GEKVTGLSYKDRNSDAHHDVDLEGIFVQIGLVPNTEWLHGAVGLTPRGEIEVDHRGETSQ
PGIFAAGDATTVPYKQIVIAMGEGSKAGLSAFDYMIRTEPAKEAVVEPA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctagacgccaatctgaaatcccagctcgaagcctacctcaagaacatcgtccatccc
gtcgaactggtcgcctcgctgggcgcggggcccaagtcgatcgagctgaagaccctgctg
gaggagatcgtgtcggtctcgcacggcaaggtcgagatgggccgcgactatgacgacgaa
cgccagcccagcttcctgatccggcgcaagggcacggacatcggcgtgcggttcgcgggc
attccgctgggccacgagttcacctcgctggtgctggccctgctgcacgtcggcggccat
ccgtccaaggcggcgcaggaggtgatccagcaggtcaaggacctggacggcgactatgtg
ttcgagacctatttctcgctgtcgtgccagaactgcccggacgtggtgcaggcgctgaat
ctgatgagcgtgattaatccgcgcatcaaacacgtcgccatcgagggcggcctgtttaag
gacgaggtcgaggaacgcaagatcatggccgtgccgacggtcttcctgaacggcgaactg
ttcggtcagggccggatggagctggagcagatcgtcgccaagctggattccggcgccgaa
gcccgcgcggccgagcgtctgaagtccaaggatccgttcgaggttctggtggtcggcggc
gggccggccggggcagcggccgccatctatacggcgcgcaagggcattcgcacgggcgtc
gtcgccgaacgcttcggcggacaggtgctggacacgatggcgatcgagaacttcgtctcg
gtcccttacaccgaaggacccaagctggcggcccatctggagcagcacgtccgcgagtat
gaagtggacctgatgaacctgcagaaggcggccaagctgatcccggccaaggttccaggc
ggcctgcacgaggtggtgctggataatggcgccagcctgaaatcacggaccgtcatcctg
tcgacgggcgcacgctggcgccagatgaacgtgccgggcgaagagcagtacaaaaacaag
ggcgtggcctattgcccgcactgcgacgggccgctgttcaagggcaagcgggtggcggtg
atcggcggcggcaactcaggcgtcgaggcggcgatcgacctggcgggcatcgtggcccat
gtgaccctgatcgaatacgacagcgagctgcgggccgatgcggtgctgcagcgcaagctg
gcgaccctgccgaacgtgcggatcgtgacctcggccctgacgactcaagtgcatggcgac
ggcgagaaggtgacgggcctgtcctacaaggaccgcaactccgacgcccatcacgacgtc
gatctggaaggcatcttcgtgcagatcggtctggtcccgaacaccgaatggctgcacggc
gcggtgggcctgaccccgcgcggcgagatcgaggtggatcaccgcggcgagacctcgcag
ccgggcatctttgcggcgggcgacgcgacgaccgtgccctataagcagatcgtcatcgcc
atgggcgaggggtcaaaggcgggtctgtcggccttcgactacatgatccgcaccgaaccg
gcgaaagaggcggtagtcgaaccggcgtga

DBGET integrated database retrieval system