KEGG   Brevundimonas sp. GW460-12-10-14-LB2: A4249_06225Help
Entry
A4249_06225       CDS       T04395                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
brg  Brevundimonas sp. GW460-12-10-14-LB2
Pathway
brg00061  Fatty acid biosynthesis
brg00780  Biotin metabolism
brg01100  Metabolic pathways
brg01212  Fatty acid metabolism
Module
brg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:brg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A4249_06225
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A4249_06225
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:brg01004]
    A4249_06225
Enzymes [BR:brg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     A4249_06225
Lipid biosynthesis proteins [BR:brg01004]
 Fatty acid synthase
  Component type
   A4249_06225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT 4HBT_2 MaoC_dehydratas AfsA
Motif
Other DBs
NCBI-ProteinID: ANC53289
UniProt: A0A160HWI6
LinkDB All DBs
Position
complement(1266781..1267275)
Genome map
AA seq 164 aa AA seqDB search
MGMSDTTAVEGKIDYAEVMRRLPHRYPFLLVDKAEDFVPATSIVGIKNVTHNEPFFPGHF
PIDPVMPGVLIVEAMAQTGALLMSKTLDVAVADKVIMFMSIDGVRFRKPARPGDQLRMEV
KVIRARGDAYKFRGETFIDGKLAAEAEFMAMVVTVPTPAPGPAA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atagggatgagcgacacgactgccgtcgaaggcaagatcgattacgccgaggtgatgcgg
cggctgccgcaccgttatcccttcctgctggtggacaaggccgaagacttcgtgcccgcg
acgtcgatcgtcggcatcaagaacgtcacccacaacgagcccttcttcccggggcacttc
ccaatcgatccggtcatgcccggcgtgctgatcgtggaggccatggcccagaccggcgca
ctgttgatgtccaagacgctggacgtcgccgtggccgacaaggtcatcatgttcatgtcg
atcgacggggttcgcttcagaaagcccgcgaggcccggcgaccaactgcgcatggaggtc
aaggtgatccgcgcgcggggcgacgcctacaagttccggggcgagaccttcatcgacggc
aagctggcggccgaagccgagttcatggcgatggtcgtgactgtgcccactccagcgcct
gggccggcggcctga

DBGET integrated database retrieval system