KEGG   Brevundimonas sp. GW460-12-10-14-LB2: A4249_12515Help
Entry
A4249_12515       CDS       T04395                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
brg  Brevundimonas sp. GW460-12-10-14-LB2
Pathway
brg00620  Pyruvate metabolism
brg00680  Methane metabolism
brg01100  Metabolic pathways
brg01120  Microbial metabolism in diverse environments
brg01200  Carbon metabolism
Module
brg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:brg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A4249_12515
  09102 Energy metabolism
   00680 Methane metabolism
    A4249_12515
Enzymes [BR:brg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A4249_12515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase LRV
Motif
Other DBs
NCBI-ProteinID: ANC54400
UniProt: A0A168NPH2
LinkDB All DBs
Position
2507195..2509894
Genome map
AA seq 899 aa AA seqDB search
MMSPAADDALRDEVRLLGGILGDIIRDEGGQALFDHVEAVRQASIAYHRDPASHPAKRLE
KLLTAMSVDQAAGLAHGFALFSLLANIAEDRSTRRRAQSQAEAGARPDTPEGALKRLADQ
GVDREAVRALLDQSLISPVLTAHPSEVRRKSVIDRIAAITDLLDACDKAGDACTLDAIAE
PLRRQIVILWATRLVRTQGLVVQDEIDTVVSFLDRIFLHVAPKQLSAWRRLLEAPGLKPF
MRVGTWVGGDRDGNPNVDATVMAAAFRTQARAVVTFYLDEVHALGAELSLAAELAQVSPE
LQALADAAHDPSPHRADEPYRRALTGVYARLATTHEKLGDAPPPRRPAVQAEPYPGPDAF
ESDLKTLHDSLVSHHGGVFADDRLSDLITAVEVFGFHMATLDMRQNADVHERVVADLLKV
AGVQSDYLALDEEGRLKVLAAELASPRLLFSPYADYEPETLKERAILQAAATALAAFGSQ
AIRTHIVSKTDAASDLLEVYLLLKEVGLYRPEDPAACPIQAAPLFETIEDLRAARPTLER
LLQEPSALAVAQARGVQEVMIGYSDSNKDGSYLTSGWELHEASRALVEVTQKHGLKLQLF
HGRGGTVGRGGGSSFAGVLAQPEGTVQGRIRTTEQGEVIANKYGEPEIALRNLDALTCGA
MLASLGKGTDHAFTAEHGATLSDLSARSMAAYRKLVYETDGFVDYYRAATPIAEIADLKI
GSRPSSRTASTRIEDLRAIPWVFSWSQSRVMLPGWFGFGSAVQGKDMGELKAMAEAWPFF
KTLVQNMEMVMAKSDMTIARRYATLVPDASLASRIYGEIREEWQRTHDAILAITGHDALL
GGQPELDRLIRLRMPYVEPLNHVQIELIRRRRAGDDDPRVREGILLAINGVAAGLRNSG
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtcccgccgccgacgacgccctgcgtgacgaggtccgactgctcggcggcatt
ctgggcgacatcatccgcgacgagggtggtcaggccctgttcgaccatgtcgaggcggtg
cgacaggcttcgatcgcctatcaccgcgacccggcctcgcaccccgccaagcggctggag
aagctgctgaccgccatgtcggtggatcaggcggccggcttggcgcacggctttgcccta
ttctctctgctggccaatatcgccgaagaccgctcgacccgccgccgcgcccagagccag
gccgaggccggcgcccggcccgacacgccggaaggcgcgctgaagcgtctggccgatcaa
ggcgtggatcgcgaggccgtgcgcgccctgctggatcagtcgctgatctcgcccgtcctg
accgcccacccgtccgaggtccggcgcaagagcgtcatcgaccgcatcgccgccatcacc
gacctgctggacgcctgcgacaaggccggcgacgcctgcaccctggacgccatcgccgaa
ccgctgcgccgccagatcgtcatcctgtgggccacgcgtctggtccgcacccaggggctg
gtggtgcaggacgagatcgacaccgtggtctccttcctggaccgcatcttcctgcacgtc
gcgccaaagcagttgtcggcctggcggcgattgctggaggcgcccgggctgaagcccttc
atgcgcgtcggcacctgggtcggcggcgaccgcgacggcaatcccaacgtggacgccacg
gtgatggccgccgccttccgcacccaggcgcgggccgtggtgaccttctatctggacgag
gtgcacgccctgggcgccgaactcagcctcgcggccgaactggcccaggtgtcgcccgag
cttcaggccctggccgacgccgcccacgacccctcgccacaccgcgcggacgagccctat
cgccgcgccctgaccggcgtctatgcccgcctcgccaccacgcacgaaaagctcggcgac
gcccccccgccccgtcgccccgcggtccaggccgaaccctatcccggccccgacgccttc
gagtctgatctgaagacgcttcacgacagcctggtgtcgcaccacggcggcgtcttcgcc
gacgatcggctcagcgacctgatcacggcggtcgaggtgttcggcttccatatggcgacc
ctggacatgcgccagaacgccgacgtccatgaacgcgtcgtcgccgacctgctcaaggtc
gcgggcgtccagtccgactatctggcgctggacgaggaaggccgcctgaaggtgctcgcc
gccgaactggcctcgccgcgcctgctgttcagcccctatgccgactatgagccggaaacc
ctgaaggagcgcgccatccttcaggcggcggcgaccgcgctcgccgccttcggctcccag
gcgatccgcacccatatcgtgtccaagacggatgcggcgtccgacctgctggaagtctat
ctgctgctcaaggaggtcggtctctaccgacccgaggaccccgccgcctgccctatccag
gccgcccccctgttcgagaccatagaggatctgcgcgccgcccgccccaccctggagcgg
ctgttgcaggaaccttccgccctcgccgtcgcccaggcgcgcggggtgcaggaggtgatg
atcggctattcggattcgaacaaggacggctcctacctgacctccggctgggagttgcac
gaggcttcgcgcgccttggtcgaggtgacgcagaagcacgggctgaagctgcaactgttc
catgggcgcggcggcacggtcgggcgcggcggcggctcgtccttcgccggcgtcctggcc
cagccggaaggcactgtccagggccgcatccgcaccaccgaacagggcgaggtcatcgcc
aacaaatacggcgagccggagatcgcgcttcgcaatctggacgccctgacctgcggcgcc
atgctggcctcgctgggcaagggcacggatcacgccttcaccgccgaacacggcgcgacc
ctgtcggacctgtcggcgcgttcaatggccgcctatcgcaagctggtctatgagaccgac
ggcttcgtcgactactaccgcgccgccacccccatcgccgagatcgccgatctgaagatc
ggctcgcgcccgtcgtcgcggacggcctcgacgcggatcgaggatctgcgcgccattccc
tgggtgttcagctggtcgcagagccgggtcatgctgcccggctggttcggcttcggttcg
gcggtgcagggcaaggacatgggcgagctgaaggcgatggccgaggcctggcccttcttc
aagaccctggtccagaacatggagatggtcatggccaagtccgacatgaccatcgcccgc
cgctacgccaccctggtccccgacgcctctctggcctcgcgcatctatggtgaaatccgc
gaggagtggcagcgcacccacgacgccatcctggccatcaccggccatgacgccctgctg
ggcggccagcccgagctggaccggctgatccggctgcgcatgccctatgtcgagccgctg
aaccacgtccagatcgaactgatccgccgccgccgcgcaggcgacgacgacccccgcgtc
cgcgagggcatccttctggccatcaacggcgtagcggccggcttgcgaaacagcggctga

DBGET integrated database retrieval system