KEGG   Brevundimonas sp. GW460-12-10-14-LB2: A4249_13435Help
Entry
A4249_13435       CDS       T04395                                 

Definition
(GenBank) fumarate reductase (quinol) flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
brg  Brevundimonas sp. GW460-12-10-14-LB2
Pathway
brg00020  Citrate cycle (TCA cycle)
brg00190  Oxidative phosphorylation
brg00650  Butanoate metabolism
brg01100  Metabolic pathways
brg01110  Biosynthesis of secondary metabolites
brg01120  Microbial metabolism in diverse environments
brg01130  Biosynthesis of antibiotics
brg01200  Carbon metabolism
Module
brg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
brg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
brg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:brg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A4249_13435
   00650 Butanoate metabolism
    A4249_13435
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A4249_13435
Enzymes [BR:brg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A4249_13435
    1.3.5.4  fumarate reductase (quinol)
     A4249_13435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_oxidored DAO HI0933_like Pyr_redox_3 FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ANC54560
UniProt: A0A161J9D6
LinkDB All DBs
Position
2713398..2715182
Genome map
AA seq 594 aa AA seqDB search
MAAYELIDHEYDVVVVGAGGSGLRAALGAAQQGLKVACVTKVFPTRSHTVAAQGGISASL
GNMGEDSWQWHMYDTVKGSDWLGDQDSIEYLVRNAPKAVYELEHWGVPFSRTEEGKIYQR
AFGGMTRNFGEGPVQRTCAAADRTGHAILHTLYGQSVRREVKFFVEYFALDLIMQDGACT
GVTALQLDNGQLHQFRAKMVVLATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPLQDMEF
VQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPTVKDLAPRDMVSRSMTIEIR
EGRGVGPNKDHIFLHLDHLDPKILHQRLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGG
IPTNYHGEVLTLRDGNPDSVVPGLMAVGEAACVSVHGANRLGSNSLTDLVVFGRAVGLRC
GEVVDKASAVPSASKSQTDQHLARLDRFRYADGSTPTAELRLSMQRAMQADAAVFRTGET
LQQGTDKLRAIEAAGADIKTTDRGLIWNTDLVETLEYDNLIAQAMVTIEGGLNRTESRGA
HAREDYPDRDDVNWMKHTLAWKRPGEQVQIDYRPVHNYTMSDDIAYIEPKARVY
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggccgcttacgaactgatcgatcacgaatatgacgtcgtcgtcgtcggcgctgggggc
tcgggccttcgcgccgcgctcggcgccgcccagcaggggctgaaggtcgcctgcgtgacc
aaggtcttccccacccgctcgcacaccgtcgcggcccagggcggcatctccgcctcgctc
ggcaacatgggcgaggacagctggcaatggcacatgtacgacaccgtcaaggggtcggac
tggctgggcgaccaggactcgatcgaatatctggtccgtaacgcgcccaaggccgtctat
gagctggaacactggggcgtgcccttcagccgcaccgaagaaggcaagatctatcagcgc
gccttcggcggcatgacccgcaacttcggcgaaggcccggtgcagcgcacctgcgccgcc
gccgaccgcaccggccacgccatcctgcacaccctgtacggccagtcggtgcgccgcgag
gtgaagttcttcgtcgaatatttcgcgctcgacctgatcatgcaggacggcgcctgcacc
ggcgtgacggccctgcaactggacaacggtcagcttcaccagttccgcgccaagatggtg
gttctggcgaccggcggatacggccgcgcctatttcagcgccacctcggcccacacctgc
accggcgacggcaatgcgatggtgctgcgcgccggcctgccgttgcaggacatggagttc
gtgcagttccacccgaccggcatctatggcgccggctgcctgatcaccgagggtgcacgc
ggcgagggcggttatctgaccaactcggaaggcgagcgcttcatggagcgctatgcgccg
accgtgaaggacctggccccgcgcgacatggtctcgcgctccatgaccatcgaaatccgt
gaagggcgcggcgtgggtccgaacaaggaccacatcttcctgcacctggatcacctggat
ccgaagatcctgcaccagcgcctgccgggcatttccgaaagcgccaagatcttcgccggc
gtggatgtgaccaaggagccgatcccggtcctgccgaccgtccactacaacatgggcggc
atccccacgaactatcacggcgaagtcctgacgctgcgcgacggcaaccccgacagcgtg
gttccgggcctgatggccgtgggcgaggcggcgtgcgtttcggtgcacggcgccaaccgc
ctgggctccaactccctgaccgacctggtggtgttcggccgcgccgtcggcctgcgctgc
ggtgaagtcgtcgacaaggcctcggccgtgccgtcggcctccaagagccagaccgaccag
cacctggcccgcctggaccgcttccgctacgccgacggctcgaccccgaccgccgagctg
cgtctgtcgatgcagcgcgcgatgcaggccgatgcggcggtgttccgcaccggcgaaacc
ctgcagcagggcaccgacaagctgcgcgccatcgaggcggccggcgccgacatcaagacc
accgatcgcggcctgatctggaatacggacctggtcgagacgctggagtacgacaacctc
atcgcccaggcgatggtgacgatcgagggtggtctgaaccgcacggaatcgcgcggcgcc
cacgcccgcgaagactatcccgatcgcgacgacgtcaactggatgaagcacaccttggcg
tggaagcgtccgggagagcaggtccagatcgattatcgtccggtccacaactacaccatg
tccgacgacatcgcgtatatcgaaccgaaggcgcgggtttactaa

DBGET integrated database retrieval system