KEGG   Brevundimonas sp. GW460-12-10-14-LB2: A4249_13440Help
Entry
A4249_13440       CDS       T04395                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
brg  Brevundimonas sp. GW460-12-10-14-LB2
Pathway
brg00020  Citrate cycle (TCA cycle)
brg00190  Oxidative phosphorylation
brg00650  Butanoate metabolism
brg01100  Metabolic pathways
brg01110  Biosynthesis of secondary metabolites
brg01120  Microbial metabolism in diverse environments
brg01130  Biosynthesis of antibiotics
brg01200  Carbon metabolism
Module
brg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
brg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
brg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:brg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A4249_13440
   00650 Butanoate metabolism
    A4249_13440
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A4249_13440
Enzymes [BR:brg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A4249_13440
    1.3.5.4  fumarate reductase (quinol)
     A4249_13440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-ProteinID: ANC54561
UniProt: A0A160I205
LinkDB All DBs
Position
2715184..2715978
Genome map
AA seq 264 aa AA seqDB search
MVQLTLPRGSKPTTGKVHKAAPGSKDVKTYKVYRYDPETDADPRWDTYEVPTGDHGPMLL
DALIHIKNTIDPTLSFRRSCREGICGSCSMNIDGRNALACTKGWDECASNNITISPLPHQ
PVVKDLVTDLSLFYAQYDSIQPYLQSDEPDPEKERLQTPAEREKLDGLYECILCACCSTS
CPSYWWNQEEYLGPAALLQSYRWISDSRDDATQKRLDDLEDPFKLYRCHTIMNCAQVCPK
GLNPAKAIAETKKLMVAPSRKKAA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggtccagcttactctccccagaggctccaagccaacgaccggcaaggtccacaaggcc
gcgccgggctccaaggacgtgaagacctacaaggtctatcgctacgatccggagaccgac
gccgatccgcgctgggacacctatgaggtgccgaccggcgaccacggcccgatgctgctg
gacgccctgatccacatcaagaacaccatcgatccgaccctgtcgttccggcgctcgtgc
cgagagggcatctgcggctcgtgctcgatgaacatcgacgggcgcaacgccctggcctgc
accaagggctgggacgaatgcgcgtccaacaacatcaccatctcccccctgccccaccag
ccggtggtcaaggacctggtgacggacctgagcctgttctacgcccagtacgactcgatc
cagccgtatctgcaatcggacgagcccgaccccgaaaaggaacgtctgcagaccccggcc
gagcgcgagaagctggacggcctgtacgagtgcatcctgtgcgcctgctgctcgacgtcc
tgccccagctactggtggaaccaggaagaatacctgggcccggcggcgctgctgcaatcc
tatcgctggatttccgacagccgcgacgacgcgacccagaagcgcctggacgacctggaa
gacccgttcaaactgtatcgctgccacacgatcatgaactgcgcccaggtctgccccaag
ggtctgaacccggccaaggccatcgccgagaccaagaagctgatggtcgcgccgagccgc
aagaaggcggcctga

DBGET integrated database retrieval system