KEGG   Brevundimonas sp. GW460-12-10-14-LB2: A4249_13540Help
Entry
A4249_13540       CDS       T04395                                 

Definition
(GenBank) bifunctional ornithine acetyltransferase/N-acetylglutamate synthase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
brg  Brevundimonas sp. GW460-12-10-14-LB2
Pathway
brg00220  Arginine biosynthesis
brg01100  Metabolic pathways
brg01110  Biosynthesis of secondary metabolites
brg01130  Biosynthesis of antibiotics
brg01210  2-Oxocarboxylic acid metabolism
brg01230  Biosynthesis of amino acids
Module
brg_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:brg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    A4249_13540
Enzymes [BR:brg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     A4249_13540
    2.3.1.35  glutamate N-acetyltransferase
     A4249_13540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: ANC54578
UniProt: A0A160HZM6
LinkDB All DBs
Position
2737199..2738593
Genome map
AA seq 464 aa AA seqDB search
MTKPPSTTGQKIEHAFEKALDPFATALKRATRTPGSDAAPTAAPAPAAAGKPGLAISPLA
VPFPTIPPIGGVEIATARAGFYKHERDDLVVFRFARGTSCAGVFTRHKIGSAPVDWCKKH
LAGAEGGKDVRALVINAGCANAFTGKAGADAARRTASEVAKRFGCRQRDVMLASTGVIGV
VLDDKKIVAKLPEIENGLEADAWARAGRGIMTTDTFPKGSYAEAEIEGYKVRIAGIAKGS
GMIAPDMATMLAFIVTDADIHPNVLQALLGLHVRTTFNSVTVDGDTSTNDTALLFATGTS
GAPRIGRVGDRRLKSFSAALDKVMLDLAHQLVRDGEGATKFVKVTVDGAASPASARKLAK
SIADSPLVKTAIAGQDANWGRVVMAVGKTEEPVDRDRLAIKFGPHQAAIDGAPSPTYDEA
KMTAYMKNPEIDIIVDVGSGRASATVWTCDLTKGYIEINGDYRS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcctccctccacgaccggccagaagatcgagcatgcgttcgaaaaggcgctg
gacccgttcgccacggcgctgaagcgcgccacccgcacgccgggatcggatgcggcgcca
accgccgcgcctgcgccggccgccgccggcaagccgggtctggccatctcgcccttagcc
gtgccgtttccgaccattccgccgattggcggggtcgagatcgcgaccgcgcgcgccggc
ttctacaagcatgaacgtgacgatctggtggtgttccggttcgcgcgggggaccagctgc
gccggggtcttcacccgccacaagatcggctcggcccccgtggactggtgcaagaagcat
ctggccggggccgagggcggcaaggatgtgcgcgccctggttatcaacgccggatgcgcc
aacgccttcaccggcaaggccggcgcggacgcggcgcggcgcacggcctcggaggtcgcc
aaacggttcggctgtcgtcagcgcgacgtcatgctggcctcgacaggcgtgatcggcgtg
gtgctggacgacaagaagatcgtcgccaaactgcccgagatcgagaacggactggaggcg
gacgcctgggcccgggccggtcgcggcatcatgaccaccgacaccttccccaagggctcc
tacgccgaggccgagatcgagggctacaaggtccggatcgccggcatcgccaagggatcg
ggcatgatcgcgccggacatggcgaccatgctggccttcatcgtcaccgatgcggacatc
catccgaacgtgctgcaggcgctgttgggcctgcacgtgcgcaccaccttcaacagcgtg
acggtggatggcgacacctcgaccaacgacacggccctgctgttcgccaccggcacctcg
ggcgcgccacgcatcgggcgggtcggcgatcgccgcctgaagagcttctcggccgccctg
gacaaggtgatgctggacctggcgcaccagctggtgcgcgacggcgaaggcgcgaccaag
tttgtcaaggtgacggtggacggggccgcctcgcccgcctcggcccgcaagctggccaag
tccatcgccgacagcccgctggtcaagaccgccatcgccggtcaggacgccaattggggc
cgggtcgtcatggcggtgggcaagaccgaggagccggtcgaccgcgaccgtctggccatc
aagttcggtccgcaccaggccgccatcgacggcgccccgtccccgacctatgacgaggcc
aagatgaccgcctatatgaaaaaccccgaaatcgacatcatcgtcgacgtgggttcgggc
cgggcgtcggcgaccgtgtggacctgcgatctgaccaagggctacatcgagatcaacggc
gactatcgctcgtga

DBGET integrated database retrieval system