KEGG   Brevundimonas sp. GW460-12-10-14-LB2: A4249_14225Help
Entry
A4249_14225       CDS       T04395                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
brg  Brevundimonas sp. GW460-12-10-14-LB2
Pathway
brg00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:brg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A4249_14225
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brg02000]
    A4249_14225
Enzymes [BR:brg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A4249_14225
Transporters [BR:brg02000]
 Other Transporters
  Pores ion channels [TC:1]
   A4249_14225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ANC54695
UniProt: A0A160I1Q0
LinkDB All DBs
Position
2865215..2865850
Genome map
AA seq 211 aa AA seqDB search
MSEEIVFYTNPMSRGRIVRWMLEEAGQPYRTVVVDYAAMKSPDYLAINPMGKVPSIAHRG
VVVTECAAICAYLADAFPEAGLAPATDDPLRGLYYRWMFFAAGPVEAAVTAKSLGQLPPP
EKSAMVGYGSFDQVIDGLEHALDRSPWILGERFSAADVYVGSQIAWGLMFKSLPERPAFT
AYAERITTRPAAVRAREIDDALIAEAKAKAD
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagagatcgtcttctacaccaaccccatgtcgcgcggacgcatcgtccgctgg
atgctggaggaggcaggccagccctatcgcaccgtcgtggtcgactatgcggcgatgaag
tcgccggactatctggcgatcaatccgatgggaaaggtgccgtccatcgcccatcgcggc
gtcgtcgtgaccgaatgcgcagccatctgcgcctatctagctgacgcttttcctgaagcc
ggcttggcgccggcgacggacgatccgctgcgcggcctttattatcgctggatgttcttc
gccgccggaccggtcgaggcggcggtgaccgccaagtcgctgggtcaactgccgccgccc
gagaagtcggccatggtcggctacggctcgttcgatcaggtgatcgacgggctggaacat
gcgctggatcgcagtccgtggatccttggcgagcggttcagcgccgccgatgtctatgtc
ggcagtcagatcgcctgggggctgatgttcaagagcctgcctgaacggccggccttcacg
gcctatgccgaacggatcacgacacgcccggccgctgtgcgcgcccgcgaaatcgacgac
gccctgatcgccgaagcgaaagccaaggcggactga

DBGET integrated database retrieval system