KEGG   Paraburkholderia rhizoxinica: RBRH_00268Help
Entry
RBRH_00268        CDS       T01355                                 

Definition
(GenBank) Peroxiredoxin reductase (NAD(P)H) (EC 1.8.1.-) / NADH oxidase H2O2-forming (EC 1.6.3.-)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
brh  Paraburkholderia rhizoxinica
Brite
KEGG Orthology (KO) [BR:brh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RBRH_00268
Enzymes [BR:brh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RBRH_00268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored DAO HI0933_like Glutaredoxin Thi4 NAD_binding_8 FAD_binding_3 FMO-like K_oxygenase AlaDh_PNT_C NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: CBW76862
UniProt: E5AUT8
LinkDB All DBs
Position
pBRH01:463703..465304
Genome map
AA seq 533 aa AA seqDB search
MLDTTLKHQLKAYLEKVSRPIDIVASVDDSDKSRELLALLDDIASLSDHIRVNVRRDEEP
RKPSFSIGEPGKPNGIRFAGVPLGHEFTSLVLALLQTGGHPLKLDDSLIQQIRELDGDYR
FETYFSLSCQNCPEVVQALNLMALINPRIHHVAIDGALFQDEVQARQIMAVPTIFLNGER
FGQGRSGIKDILAKLDSGASARAAQALQDKPVFDVLVVGGGPAGAAAAIYAARKGIATGV
VAERFGGQVLDTLAIENFVSVQETEGPKFATALEQHVTQYDVDIMDTQRAEALIPGPIHQ
VRLASGAVLEAKAVILATGARWREIDVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVSHVTLLEYGPRLRADAVLQRKLHSLPNVTVITQAQTARITGDGSKV
DGLTYRDLRTGESQHIELAGVFVQIGLVPNTEWLKGTVELSTHGEIVVDAKGGTSIPGVF
AAGDVTTVPFKQIVIAIGEGAKASLGAFDHLIRHADPVVTEPVTVQPIRGGTA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaccctgaagcatcaactcaaagcgtacctggaaaaggttagtcggcca
atcgacatcgtcgcatcggtcgacgacagcgacaagtcgcgcgaactgctcgcgttgctc
gacgatattgcgtcgctgtccgaccacatccgtgtcaacgtgcggcgcgacgaggaaccg
cgcaagccgtcgttctcgattggcgagccgggcaagcccaacggcatccgctttgcgggc
gtcccgctcggccacgagttcacgtcgctggtacttgcgctgctgcagaccggcggacac
ccattgaagctcgacgattcactgattcagcagatccgtgaattggacggagactaccgg
tttgaaacgtatttttcgctgtcctgccaaaactgcccggaagtcgtgcaagcgctcaac
ttgatggcattgatcaacccacgcatccatcatgtcgcgatcgatggcgcgctgttccag
gatgaggtccaagcccggcaaatcatggcggtacccacgattttcctgaacggtgaacgc
ttcggccaagggcgtagcggcatcaaggatatccttgccaagctggacagcggcgcgagc
gcgcgcgcggcgcaggcactacaggacaagccggtgttcgacgtactggttgtcggtggc
ggaccggcaggcgcggccgccgctatctacgccgcgcgcaaggggatcgccacaggggtg
gtggccgaacgcttcggcgggcaagtactcgatacactggcaatcgagaatttcgtgtcg
gtgcaggaaacggaaggacccaagttcgccacagcgctcgaacagcacgtgacccaatac
gacgtcgatatcatggatacgcaacgggccgaagcactcattcccggccccatacatcag
gtgcggctcgccagcggcgcggtgctggaggcgaaagccgtcatcctcgccaccggcgcg
cgctggcgcgagatcgacgtgccgggcgagcgagaatatcgcaaccgcggtgtcgcctat
tgtccgcactgcgacggccccctcttcaagggcaagcgcgtcgccgtcgtggggggcggc
aattcgggcgtcgaagcagccatcgacttggcgggcattgtcagtcatgtcacgctgctc
gaatacggcccccggttgcgcgccgacgcggtgttgcagcgcaagttgcacagcctgccc
aacgtcacggtgatcacgcaggcacagaccgcccgcatcacgggcgacggcagcaaggta
gacgggctgacgtaccgggatcttcgcacaggcgagtcgcaacacatcgaactggcgggt
gtgttcgtgcaaatcggcctggtgcccaataccgagtggctgaagggcacggtcgagttg
tcgacgcacggcgaaatcgtcgttgatgccaagggggggacgtcgataccgggggtgttc
gctgctggcgacgtgaccacggtgccattcaagcagatcgtgatcgctattggcgaagga
gcgaaagcgtcgctcggcgcgttcgaccacctaatccgccacgctgacccggtagtgacc
gagccggtgaccgtgcagcccattcgcggcggcacggcgtag

DBGET integrated database retrieval system