KEGG   Paraburkholderia rhizoxinica: RBRH_00537Help
Entry
RBRH_00537        CDS       T01355                                 

Definition
(GenBank) S-CRYSTALLIN
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:brh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RBRH_00537
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brh02000]
    RBRH_00537
Enzymes [BR:brh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RBRH_00537
Transporters [BR:brh02000]
 Other Transporters
  Pores ion channels [TC:1]
   RBRH_00537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: CBW76618
UniProt: E5AU44
LinkDB All DBs
Position
pBRH01:complement(208824..209651)
Genome map
AA seq 275 aa AA seqDB search
MHAGSPAADGRCPSAHCPSTVIMSYELYYWPGLQGRGEFVRLALEEAGADYLDVARLPPS
GRREDANPQGTEHGIGAMMSILQSQTEPYLPFAPPFLRDGTTLVAQTANILLYLGPRLGL
APADEALRHWVHGLQLTIADMVTEAHDTHHPIASALYFEQQRDAARQRAADFIANRIPKF
MHYFERVLEQNPAGCTHLVGATLSYADLSMFQLIDGLHYAFPRATARFATQYPKLTALHE
AVRTRPRIAAYLASPRRVPHNESCVFRHYAELDTR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgcacgccgggtcaccggctgccgacggccgctgtccgtcggcacactgtcccagcact
gtgattatgagctacgaactgtactactggccgggcttgcagggccgcggtgaattcgtc
cgcctagcgctcgaagaggcgggtgcggattatctcgacgtcgcgcgcctgccgccgtcc
ggtcgccgcgaggacgccaatccgcagggcacggagcacggcatcggcgcgatgatgtcg
atcctgcaaagccaaaccgagccctacctcccattcgctccccccttcctgcgcgacggc
acgacgctcgtcgcgcagaccgctaacatcctgttgtacctagggccccggctcggcctg
gcgcccgccgatgaagcgctacgccactgggtccacgggctacagctgacgattgccgac
atggtgaccgaggcacacgacacgcaccacccgatcgccagcgcgctgtatttcgagcag
cagcgcgacgccgcccggcagcgcgccgccgatttcatcgccaaccgaataccgaagttc
atgcattatttcgagcgtgtgctcgagcagaatcccgcgggatgcacgcacttggttggc
gcgacattgagctacgcagacctgtcgatgttccaactcatcgatggactgcactacgcg
tttccgcgtgccaccgctcgcttcgcgacacagtatccgaagctcacggcgctacatgaa
gcggtgcgcacgcggccgcgcatcgccgcgtacctggcgtcgcctcgccgcgtcccgcac
aacgagtcgtgcgtgttccggcactacgcggaattggacacgcgttga

DBGET integrated database retrieval system