KEGG   Mycetohabitans rhizoxinica: RBRH_02824
Entry
RBRH_02824        CDS       T01355                                 

Definition
(GenBank) Isocitrate lyase family protein / Nucleotidyltransferase family protein
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
brh  Mycetohabitans rhizoxinica
Pathway
brh00440  Phosphonate and phosphinate metabolism
brh00998  Biosynthesis of various secondary metabolites - part 2
brh01100  Metabolic pathways
brh01110  Biosynthesis of secondary metabolites
brh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:brh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    RBRH_02824
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    RBRH_02824
Enzymes [BR:brh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     RBRH_02824
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL PEP_hydrolase IspD
Other DBs
NCBI-ProteinID: CBW77005
UniProt: E5AV81
LinkDB
Position
pBRH01:complement(606542..608359)
AA seq 605 aa
MDRNRFCRGCRARANAGTALAAAGGRGEHERITLRQELVEFMNAPDTFVARAPSRAARLR
RMLTSDKLEFMMEAHNGLSARIVREAGFDAIWASGLAISAQYGVRDNNEASWTQVVDTLE
FMVDASDLPILLDGDTGYGNFNNVRRLVKKLEQRGVAGVCIEDKQFPKTNSFIGGERQPL
ADVDEFCGKIKAGKDSQGDPDFSIVARVEALIAGWGMDEALRRAEAYHAAGADAILIHSK
LARADEIVAFAREWAHRAPLVIVPTKYYSTPTQVFRNAGISVVIWANHLIRAATSAMQAV
AKEIHDSETLVGVEDRVASVNEIFRLQGADEYSAAERVYLTARAPRTALVLAASRGRGLE
AVTAQRPKVMLPIAGKPLLRWLVDGFKKQGVNDITVVGGYRADAIDTAGIRLVVNERHET
TGELASLACATQAFEHDTVISYGDLLFRSYILHDLVESDAHFCVIVDSSQTQPTNQSVRD
FAYCSSGDDRGLFGQKVVLRRVSSEATAPDGTAPHGRWIGLLGVHGEGREKLQRIFATLR
ERGDFDSLDMPALLNALVDAGEQIEVQYVHGHWRGVNDLDDFRRAADFAHTQVPIAEASA
GGGND
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggatcgaaatcgattttgccgcggatgtcgagcgcgcgcgaacgcaggtactgccctt
gctgcagccggtggtcgtggcgagcacgaacgcatcacgttgagacaggagctggttgaa
ttcatgaacgcccccgatacctttgtcgcacgcgcgccaagccgtgcggcgcggctgcgc
cgcatgctgacctccgataagctggaattcatgatggaggcgcacaacgggctgtccgcg
cggatcgtgcgcgaagcgggctttgacgccatttgggcgtcgggcctagcgatctcggcg
caatacggcgtgcgcgacaataatgaggcgagctggacacaggtggtcgacacgctggaa
ttcatggtcgatgcgagcgacctaccgattctgcttgacggcgataccggctacggcaat
ttcaacaacgtgcggcggctggtcaaaaagctggagcagcgcggcgtggccggcgtgtgc
atcgaggacaagcaattcccgaagaccaacagcttcatcggcggcgaacggcagccgcta
gcggacgttgacgagttctgcggcaagatcaaggccggcaaggattcgcagggcgacccg
gacttttcgattgtcgcgcgggtcgaggcgttgattgccggttggggcatggacgaggcg
ctgcgccgcgccgaggcgtatcatgcggccggggccgatgcgattctgatccacagcaag
ctggcgcgagccgacgaaatcgtggcatttgcgcgtgaatgggcccatcgtgctccgttg
gtgatcgtgccgacgaagtactacagtacgccgacgcaggtcttccgcaatgcgggtatc
agcgtcgtgatttgggcgaatcacttgatacgcgcggctacatcggcgatgcaggccgtc
gccaaggaaattcacgacagcgagacgctggtcggcgtcgaggaccgggtcgcgtcggtc
aatgagattttccgcttgcaaggcgcggacgaatattcggccgccgagcgcgtctatctg
accgcacgcgcaccgcgcacggcgctcgtgctggccgcgagccgggggcgtggactggag
gcggtcaccgcgcagcggcccaaggtgatgttgcccatcgcgggtaagccgttgctacgc
tggctcgtcgatggcttcaagaagcagggcgtgaacgatatcacggtcgtgggcggctac
cgtgccgatgcgatcgacacggcgggcattcgcctggtggtcaacgagcggcacgagacg
accggcgagctggcgtcgctcgcgtgtgcgacgcaggcgttcgagcacgataccgtcatc
tcgtatggtgatctattgtttcgcagctatatcctgcacgacctggtcgaaagcgatgca
cacttttgcgtgatcgtcgattcgtcgcagacgcagccgaccaaccagagcgtgcgcgat
ttcgcgtactgctccagtggcgacgaccggggcctgttcgggcagaaggtcgtgctgcgg
cgcgtgagcagcgaggcaaccgcgccggatggcacggcgccgcacgggcgctggattggc
ctgctgggcgtgcatggtgaaggacgcgagaaacttcagcgtatttttgcgacgctgcgc
gagcgcggcgacttcgattcactggacatgccggcgctgctcaatgcgctggttgatgcc
ggtgagcagatcgaagtgcaatatgtgcatggacactggcgtggcgttaatgacctggac
gattttcgccgggcggcggatttcgcccatacgcaggtcccgatcgcggaggcgagcgcc
ggaggcggcaatgattga

DBGET integrated database retrieval system