KEGG   Paraburkholderia rhizoxinica: RBRH_03119Help
Entry
RBRH_03119        CDS       T01355                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00620  Pyruvate metabolism
brh00680  Methane metabolism
brh01100  Metabolic pathways
brh01120  Microbial metabolism in diverse environments
brh01200  Carbon metabolism
Module
brh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:brh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RBRH_03119
  09102 Energy metabolism
   00680 Methane metabolism
    RBRH_03119
Enzymes [BR:brh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RBRH_03119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase F_actin_bind PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CBW74148
UniProt: E5ANG6
LinkDB All DBs
Position
complement(593492..596506)
Genome map
AA seq 1004 aa AA seqDB search
MPEPFNRQFGEWLVTTSGSAAAARRNAKTAATASRTAPARPTPTVGTPTAHATASPTRSR
TREDKDRPLFEDIRFLGRLLGDVVREQEGDAVFDVVETIRQSAVKFRREDDIDAAKKLDK
MLKALTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQAGTVAYALARLAK
SGGESLSALKTFFDTGLIVPVLTAHPTEVQRKSILDAQHDIARLLAEHDQPLTARERAAN
EALLRARVTSLWQTRMLRDSRLTVADEIENALSYYRTTFLDEIPALYADIEQALAEHGLP
TRLPPFFQMGSWIGGDRDGNPNVTAATLERAITRQAAVLFQHYLEQVHRLGAELSVSELL
AGSSDALKQLADTSPDTSPHRVDEPYRRALIGVYARLAATARALLGDAAVSIRGEHRDAA
PYASPDAFRADLQVLIDSLQARHGASLAAPRLSPLARAVEVFGFHLASIDLRQSSDVHET
VLTELFARAGVVDDYAALSEDDKLTLLLAELAQPRALRLPYAEYSPLVHSELAVLEATRV
IRQRFGERAVRNYIISHTETVSDLVEVMLLQKETGLMHGSMPACGAAAGNGQHATHAGQG
APRVSLMVIPLFETIADLRHAPRIMQALLALPGMDSIVRHQGGEQEVMLGYSDSNKDGGF
LTSNWELYRAELALVALFRERGVRLRLFHGRGGTVGRGGGPTYQAILSQPPGTVDGQIRL
TEQGEVIASKFGNPEIGRRNLETVVAATLEATLQPHAQSPRALPQFEALMQTLSDAAMSA
YRTLVYKTPGFTDYFFESTPIAEIAELNIGSRPASRKLHDPKHRRIEDLRAIPWGFSWGQ
CRLLLTGWYGFGSAISAYLDAAPDALDREKRVALLRKMVKTWPFFSNLLSNMDMVLAKSD
LAVASRYAQLVPDKKLRKQVFGQIVAEWHRTTDALAQITGHSSRLADNPLLARSIKNRFP
YLDPLNHLQVELLRRHRAGTTNARLRRGIHLTINGIAAGLRNTG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgccggaacccttcaatcgccagtttggggaatggcttgtgactacttccggatcggcc
gctgccgcgcgccgcaacgccaagaccgccgctacggcctcccgcaccgcgcccgcacgg
ccgaccccgaccgtggggacgccgacggcgcacgccacggcatcgcccacacgcagccgc
acccgcgaagacaaggacaggccgctgttcgaggacatccgcttccttggccgactgctt
ggtgacgtggtccgcgagcaagagggtgacgccgtattcgacgtggtcgagacgatccgc
cagtcggcggtgaaatttcgccgcgaggacgacatcgacgcggccaagaagctagacaag
atgctcaaggccctcacgccggagcaaacggtcagcgtggtgcgcgcattcagctacttt
tcacatctagcaaacatcgccgaggatcgccaccataatcgccgccggcgcatccatgcg
ctggccggctccgcaccacaggcaggcaccgtcgcctacgcgcttgcacggctggctaaa
agtggtggcgaatcgctgtccgcgctaaagacgttcttcgacaccgggctgatcgtgccg
gtgctcaccgcacatcccaccgaggtgcagcgcaagagcatcctggacgcgcagcacgac
atcgcacgcttgctggccgagcatgaccagccgctcaccgcgcgcgagcgcgcggccaac
gaagcgctgctgcgcgcccgcgtcacatcactgtggcaaacccgcatgctgcgtgattca
cggctcacggtcgccgacgagatcgaaaacgcgctgtcgtactatcgcacgaccttcctg
gacgagatcccggcactgtacgcggacatcgaacaggcactggccgagcacggcctgccc
actcgactgcccccgttcttccagatgggtagttggatcggcggcgaccgcgacggcaat
ccgaacgtaacggcggccacgctcgagcgggcgattacgcgccaggcggcggtgctcttc
caacactatctggaacaggtgcaccggctcggcgcggagctgtccgtctccgagttgctc
gcaggctccagcgacgcgctgaagcaactggcggatacctcgcccgatacctcgccgcac
cgcgtagacgagccgtatcggcgcgcgctgatcggtgtctacgcacggctggccgcgact
gcgcgcgcgctgctcggcgacgcagccgtctcgatccgtggcgagcaccgcgacgcggcg
ccctatgcgtcgcccgacgcattccgcgccgacctgcaggtgttgatcgactcactgcag
gcgcgccacggcgcgtcgcttgccgccccgcggctgtcaccgctcgcccgcgcggtcgaa
gtattcggctttcatcttgcgagcatcgacctgcggcaaagttcggatgtccacgaaacc
gtgctgaccgagctgtttgcccgtgccggcgtggtcgacgactatgccgcgttgtccgag
gacgacaagctgacgctgctgctggctgaactggcgcagccgcgcgctttgcgcctgccg
tacgcggagtactcgccgctggtgcacagcgagcttgccgtgctggaggccacgcgtgtg
atacggcagcgctttggcgagcgggccgtgcgcaactacatcatctcccataccgagacc
gtatcggacctggtcgaagtgatgctgctgcaaaaggaaaccggcctgatgcacggcagc
atgcccgcctgcggggccgcggcgggcaatggccagcacgcaacccatgctgggcagggt
gcgccgcgcgtcagtttaatggtgattcccctgttcgagacaatcgccgacctgcgtcac
gcgccgcgcatcatgcaagcgctgctggcgctgccgggcatggactcgatcgtgcgccac
cagggcggcgaacaggaagtgatgctcggctactcggacagcaacaaggacggtggcttc
ctcacgtcgaactgggaactgtatcgggccgaactggcgctggtcgcgctgttccgcgag
cgcggcgtgaggctacgactgtttcacggccggggcggcacagttgggcgcggcggcggc
ccgacctatcaggcgatcctgtcgcagccaccgggcacagtggatgggcagatccggttg
accgagcaaggcgaggtgattgccagcaagttcggcaatccggaaatcggccgccgcaat
cttgagaccgtggtagccgcgacgctggaggcgacgttgcagccacatgcccagtcaccg
cgcgcgctgccgcagttcgaggccctgatgcagacgctgtcagacgcggcgatgtcagca
taccgcacgctcgtgtacaagaccccgggcttcaccgactatttcttcgagtccacgccg
attgccgagattgcagaactcaatatcggcagccgccccgcctcgcgcaagctgcacgat
cccaagcatcgccgcatcgaggacttgcgcgcgattccatggggcttctcgtggggtcaa
tgccggctgctgcttaccggctggtacggctttggcagcgcgattagcgcgtacctggat
gctgcgccggatgcgctggaccgggaaaagcgcgtggcgctgctgcgcaaaatggtcaag
acgtggccgttcttctcgaacctgctgtccaacatggacatggtgctcgctaagtcagat
ctggcggtcgcgtcgcgctatgcgcaactcgtgccggacaagaagcttcgcaagcaggta
ttcggccagatcgtcgccgaatggcatcgcaccacggacgcgctcgcgcagatcaccggc
cattcgtcgcggctggcggacaatccgctgctcgcccgctcgatcaagaaccgcttcccg
tacctcgatccgctgaaccacttgcaggtcgaactgctgcgccggcaccgcgcgggcacc
acgaacgcacgactgcgccgcggcattcacttgacgatcaatgggatcgccgcagggttg
cgtaatacgggctga

DBGET integrated database retrieval system