KEGG   Brevibacterium sp. CS2: FDF13_05850Help
Entry
FDF13_05850       CDS       T05958                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
bri  Brevibacterium sp. CS2
Pathway
bri02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bri00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    FDF13_05850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bri02000]
    FDF13_05850
Enzymes [BR:bri01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     FDF13_05850
Transporters [BR:bri02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    FDF13_05850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_23 AAA_22 AAA_29 RsgA_GTPase AAA_30 AAA_33 AAA_16 Rad17 AAA NB-ARC PRK NACHT ATPase_2 AAA_24 AAA_18 AAA_25 G-alpha RNA_helicase
Motif
Other DBs
NCBI-ProteinID: QCP04878
UniProt: A0A4P8HAW8
LinkDB All DBs
Position
complement(1323179..1323958)
Genome map
AA seq 259 aa AA seqDB search
MSKRIDARNLNVYYSKFLAVEDVNINIEPRSVTAFIGPSGCGKTTFLRTINRMHEVIPGA
YAEGELLLDGDNIYAPGVDPVNVRAMVGMVFQRPNPFPTMSIRDNILAGHRLNGARMSRS
EADDIVERSLRGSNLWNEVKDRLDRPGSGLSGGQQQRLCIARTIAVSPDVILMDEPCSAL
DPISTLAIEDLINDLKEEYTVVIVTHNMQQAARVADKTAFFNIAGTGKPGKLIEYDDTST
IFSNPANEETQNYISGRFG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcgcatcgacgcccgtaacctcaacgtctactacagcaagttccttgcggtg
gaggacgtcaacatcaacatcgagccgcgctcggtgaccgcgttcatcggtccgtccggc
tgcggcaagaccaccttcctccgcaccatcaaccgcatgcacgaggtcatccccggcgcc
tacgccgagggtgagctgctccttgacggcgacaacatctacgcccccggcgtggacccg
gtcaacgtccgcgcgatggtcggcatggtgttccagcggcccaacccgttcccgacgatg
tcgatccgcgacaacatcctcgccggccaccggctcaacggcgcgcggatgtcgcgctcg
gaggccgacgacatcgtcgagcgctccctgcgcggttcgaacctgtggaacgaggtcaag
gaccgcctggaccgccccggctccggtctgtccggcggtcagcagcagcgtctgtgcatc
gcccgcacgatcgccgtctcgcccgatgtcatcctcatggacgagccgtgctccgctctc
gacccgatctccacgctcgcgatcgaggacctcatcaacgatctcaaggaggagtacacg
gtcgtcatcgtcacgcacaacatgcagcaggccgcgcgcgtggcggacaagaccgcgttc
ttcaacatcgccggcaccggcaagcccggcaagctcatcgagtacgacgacacgagcacg
atcttctccaacccggcgaacgaggagacccagaactacatctccggtcgcttcggctga

DBGET integrated database retrieval system