KEGG   Bradyrhizobium sp. SK17: CWS35_05440Help
Entry
CWS35_05440       CDS       T05325                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CWS35_05440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brk02000]
    CWS35_05440
Enzymes [BR:brk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CWS35_05440
Transporters [BR:brk02000]
 Other Transporters
  Pores ion channels [TC:1]
   CWS35_05440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 Tom37 GST_C_5
Motif
Other DBs
NCBI-ProteinID: AUC93803
UniProt: A0A2K8Y8P2
LinkDB All DBs
Position
1180434..1181030
Genome map
AA seq 198 aa AA seqDB search
MIKLYWSPRSRSFSAIWLLEESGLPYERVLTDISTGAQKSKEFLEINPMGKVPALTDGDA
KLAEAAAICAYIADRYPETRLAPATTDPKRARYLQWLFFSPSCIEPALIQLFTKLEVPTS
TAAWGSAAQVFDVLDAELQKGPWILGDQFSAADIAIGAGLNFAVRVFKMVPPRPAFDAYI
DRCVARPAFQRAEKIAAG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctttactggtcgccgcgctcgcgctcgttctccgccatctggctgctggag
gagagcggcctgccttacgaacgagtgctgaccgatatcagcaccggtgcgcagaagtcg
aaggagtttctcgagatcaacccgatgggcaaggtgccggcgctgaccgacggcgacgcg
aagctcgccgaggcggcggcgatctgcgcctacatcgccgaccgctatcccgagaccagg
ctcgcgcccgccacgaccgatccgaagcgtgcacgctatctgcaatggctgttcttctcg
ccgagctgcatcgagccagcgctgatccagctgttcaccaagctcgaggtgccgaccagc
accgcggcatggggcagcgcggcacaggtgttcgacgtgctcgacgcggaattgcagaag
gggccgtggattctcggcgatcagttctccgccgccgacatcgcgatcggcgccggactg
aacttcgccgtgcgggtgttcaagatggtgccgccgcggccggcgttcgatgcctatatc
gatcgctgcgtggcgcggccggcgttccagcgcgcggagaagatcgcggcagggtga

DBGET integrated database retrieval system