KEGG   Bradyrhizobium sp. SK17: CWS35_14085Help
Entry
CWS35_14085       CDS       T05325                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00564  Glycerophospholipid metabolism
brk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CWS35_14085
Enzymes [BR:brk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CWS35_14085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox FAD_binding_3 FAD_oxidored Pyr_redox_2 FAD_binding_2 TMEM240
Motif
Other DBs
NCBI-ProteinID: AUC95250
UniProt: A0A2K8YCB7
LinkDB All DBs
Position
3026523..3028067
Genome map
AA seq 514 aa AA seqDB search
MDRIYDLAIIGGGVNGCGIARDAAGRGNSVFLCEMNDLASGTSSWSTKLVHGGLRYLEYY
EFRLVREALIEREILWQIAPHIIRPLRFVLPHHAGLRPAWLLRLGLFLYDHIGGRHLLPA
TRSVDLTRDVVGKPLIPGRYSKGFEYSDCFVDDARLVALTARDAADRGAEIRTRTRAVET
RQVDGVWHVTVEDTTNGSRDTIKSRVLVNAGGPWVEQVLASGAGVNARAKVRLVQGSHIV
VPKLYDHDRAYIFQNADGRIIFVIPYQGDFSLIGTTDRDYDGDPAKVKATREEIEYLCAS
ASEYLAKPVKPEDVVWDYSGVRPLYDDGASEAKAATRDYVFELDTPGGAPLLSIYGGKIT
TYRRLSEEALERLAPYLNGAKAQEGWTGKAPLPGGDMDVSAVAALTAELVRTYPFLAQPH
ANRLAHAYGTRARKVLGNAASAEDLGRAFGATLTESEVRYLMANEWARTAQDVVWRRSKL
GLRMTAGEIAALEEWMAANRVSGERPLREAGGRA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
ttggatcgaatttacgacctcgccatcatcggaggcggcgttaatggctgcggcatcgcg
cgcgatgcggcgggccggggtaactctgttttcctttgtgaaatgaatgatttggcgagc
gggacgtcgtcctggtcgaccaagctcgtgcatggcggtctgcgctatctcgaatattac
gagtttcgtttggtgcgcgaggcgctgatcgagcgcgagatcctctggcagatcgcaccc
cacatcatccgtccgctgcgtttcgtcttgccgcaccatgccggcctgcgcccggcctgg
ctgctgcggctcggcctcttcctctacgatcatatcggcggccggcacctgctgccggcg
acgcgctcggttgatctgacgcgcgacgtcgtcggcaagccgctgatcccgggccgctac
agcaagggctttgaatattccgattgcttcgtcgacgacgcgcggctcgtcgcgctgacc
gcgcgcgatgctgccgaccgcggcgccgagattcgcacccgcacccgcgcggtcgagacc
aggcaggtcgacggagtctggcatgtgacggtcgaggacaccaccaacggctcgcgcgac
accatcaagtcgcgcgtgctggtcaacgccggcggcccctgggtcgagcaggtgctggcg
tcgggcgccggcgtcaacgcgcgcgccaaggtgcggctggtgcagggctcgcacatcgtg
gtgcccaagctctatgaccacgaccgcgcctacatcttccagaacgccgacggccgcatc
atcttcgtcattccctatcagggcgatttttcgctgatcggcaccaccgaccgcgactat
gacggcgatccggccaaggtgaaggcgacgcgggaggagatcgagtatctctgcgcctcg
gcgagcgagtaccttgccaagccggtgaagcccgaggatgtggtctgggattattccggc
gtgcgtccgctctatgacgacggcgcgagcgaagccaaggctgcgacccgcgactatgtg
ttcgagctcgatacgccgggcggcgcgccgctgctgtcgatctacggcggcaagatcacg
acctaccgccgcctctccgaagaggcgctggagcggctcgcgccttatctcaacggcgcg
aaagcgcaggagggctggaccggcaaggcgccgctgcccggcggcgacatggatgtttcc
gcggtcgcggcgctgaccgccgaactggttcgtacctatccgttcctcgcgcagccccat
gccaaccgcctggcgcatgcctacggcacgcgcgcccgcaaagtcctcggcaatgcagca
tcggccgaagatctcgggcgcgccttcggcgccaccttgacggagagtgaagtccggtac
ctgatggcgaacgaatgggcccggaccgcgcaagatgtcgtctggcgacgatccaagctg
ggcctgcggatgacggcgggtgaaatcgccgcgctcgaagagtggatggccgccaaccgc
gtgtccggtgaacgtcccctccgcgaagcgggaggacgggcatga

DBGET integrated database retrieval system