KEGG   Bradyrhizobium sp. SK17: CWS35_17205Help
Entry
CWS35_17205       CDS       T05325                                 

Gene name
ntrB
Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00910  Nitrogen metabolism
brk02010  ABC transporters
Module
brk_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CWS35_17205 (ntrB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CWS35_17205 (ntrB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brk02000]
    CWS35_17205 (ntrB)
Transporters [BR:brk02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    CWS35_17205 (ntrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AUC95786
UniProt: A0A2K8YDR6
LinkDB All DBs
Position
3733458..3734357
Genome map
AA seq 299 aa AA seqDB search
MSMPAIKTELSAVAIPQAAAAPVVTMTPKRAPHTETYARMAKETAARVLPPLIVIALLLV
VWELICRRAGSSLPPPSKVFKDTKELILDPFFDHGGIDKGLFWHLSASLQRVAYGYSLAA
IAGIALGTLVGQSVWAMRGLDPLFQVLRTIPPLAWLPLSLAAFRDGQPSAIFVIFITSVW
PIIINTAVGIRNIPQDYRNVAAVVQLNPLEFFTKIMIPAAAPYMFTGLRIGIGLSWLAIV
AAEMLIGGVGIGFFIWDAWNSSHISEIILALFYVGIIGFVLDRLIAGAGKVVTRGTAAN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgcctgccataaagaccgaactgtcagcggtggcgatcccgcaggccgccgcg
gcgccggtcgtgaccatgacaccgaagcgcgcgccgcataccgagacctacgccaggatg
gcgaaggagaccgcggcgcgtgtgttgccgccgttgatcgtgatcgcgctgctgctcgtc
gtgtgggagttgatctgccggcgcgccggctccagcctgccgccgccgtcgaaggtgttc
aaggacaccaaagagctgatcctcgatccgttcttcgaccatggcggcatcgacaagggc
ctgttctggcatctctccgccagcctgcagcgggtcgcctatggctactcgctggcagcg
atcgccggcatcgcgctcggcacgctggtcggccagtcggtgtgggcgatgcgcgggctc
gatccgttgttccaggtgctgcgcacgatcccgccgcttgcctggttgccgctgtcgctt
gccgcgttccgcgacggccagccctcggcgatcttcgtcatcttcatcacctcggtctgg
ccgatcatcatcaacaccgcggtcggcatccgcaacatcccgcaggactaccgcaacgtc
gccgcggtggtgcagctcaatccgctggagttcttcaccaagatcatgatcccggcggct
gcgccctacatgttcaccggcctgcgcatcggcatcggcctgtcatggctcgcgatcgtt
gcggccgagatgctgatcggtggcgtcggcatcggcttcttcatctgggacgcgtggaat
tcctcgcatatcagcgaaatcatcctggcgctgttctatgtcggcatcatcggcttcgtg
ctcgatcgcctcattgcgggcgcgggcaaagtcgtgacccgcggcacggcggcgaattga

DBGET integrated database retrieval system