KEGG   Bradyrhizobium sp. SK17: CWS35_18000Help
Entry
CWS35_18000       CDS       T05325                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00620  Pyruvate metabolism
brk00680  Methane metabolism
brk00710  Carbon fixation in photosynthetic organisms
brk01100  Metabolic pathways
brk01120  Microbial metabolism in diverse environments
brk01200  Carbon metabolism
Module
brk_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CWS35_18000
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CWS35_18000
   00680 Methane metabolism
    CWS35_18000
Enzymes [BR:brk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CWS35_18000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AUC95924
UniProt: A0A2K8YE75
LinkDB All DBs
Position
3911297..3914104
Genome map
AA seq 935 aa AA seqDB search
MSPQTMPSETDLGTRSAAEAGLLDRAAQEEDARLRNDIRLLGRVLGDTVRDQEGADAFDL
VERIRQTSVRFHRDEDKLARRELEGILDSMSIAETLRIVRAFSYFSHLANIAEDQNNIRQ
MRSLGPNGAPRPSTLEQTLVHARQAGISPADLRSFFKGALVSPVLTAHPTEVRRKSTMDR
EMEIADLLDRRERLQMTPDESDASDEQLRRAVVTLWQTNLLRRTKLTVLDEVANGLSFYD
YTFLQELPRLHCALEDRLNKEVGEAGELASFLRMGSWIGGDRDGNPFVTAEVMRGTLRLQ
SSRVLSFYLEELHALGAELSLAAHLADISEELRVLAERSPDTSPHRSGEPYRLAVSGIYA
RLAATAMRLEVETTRPPVGKAEPYASVSEFQADLDVLNRSLIANNSGVIARGRLRQLRRA
VDCFGFHLARLDIRQNSAVHERTIAELFDTANPGMSYLALGEEARVSLLLGELRSARPLA
SPFVKYSEETQSELAVFRAAAEAHGKFGPEVISQCIISMCKGMSDMLEVAVLLKEVGLVN
PSGRSAINIVPLFETIEDLQASSGIMDRMLALHDYRRLVDSLGGVQEVMLGYSDSNKDGG
FVTSGWELYKAEIGLVEVFERHGMRLRLFHGRGGSVGRGGGPSYDAIIAQPGGAVNGQIR
ITEQGEIISSKYSNAEVGRSNLEILAAATLETSLLQPRQSAPRPEYLKAMEEISALAFKA
YRGLVYETPGFADYFWGSTVINEIATLNIGSRPASRKKTREIEDLRAIPWVFSWAQCRLM
LPGWYGFGAAVETWIAEHPEQGMPFLQELYKEWPFFRTLLSNMDMVLAKSSIAIASRYAE
LVPDVALREKIFGQIRREWHLSIETLLDIMGHDRLLQGNPLLERGIRNRFPYMDPLNHVQ
VELLKEHRAQNPDEQVLRGIQITINGISAGLRNSG
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccccagaccatgccttccgagaccgacctaggtaccaggagcgccgctgaagcc
ggcctcctcgatagggcggcgcaggaggaggacgcgcggctccgcaacgacatccgcctg
ctgggacgtgtgctgggcgacaccgtgcgggaccaggagggcgccgacgcgttcgacctg
gtcgagcgcatccgccagacctcggtccggttccaccgcgatgaggacaagctggcccgg
cgcgagctcgagggcatcctcgacagcatgtcgatcgccgagacgctgcggatcgtccgc
gccttcagttatttctcccacctcgccaacatcgccgaggaccagaacaacatccgccag
atgcgcagcctcggccccaacggggcgccgcggccgagcacgctggagcagaccctggtc
catgcccgtcaggccggcatcagcccggccgacctgcgcagcttcttcaagggcgcgctg
gtcagcccggtgctgacagcgcatccgaccgaggtccgccgcaagagcacgatggaccgc
gagatggagatcgccgatctgctcgatcgccgcgagcggttgcagatgacgccggacgag
agcgacgccagcgacgagcagcttcgccgcgcggtggtgacgctgtggcagaccaatctg
ctgcgccggaccaagctgaccgtgctcgacgaggtcgccaacggcctgtcgttctacgac
tacactttcctgcaggaactgccgcggctgcattgcgcgctggaggaccggctgaacaag
gaagtcggcgaggccggcgagctcgcctcgttcctcaggatgggaagctggatcggcggc
gaccgcgacggcaatccgttcgtgacggcggaggtgatgcgcggcacgctgcggctgcaa
tcgagccgggtgctcagcttctacctcgaggaactgcacgcgctcggcgccgagctgtcg
ctcgcggcccatctcgccgatatctcggaggagttgcgggtcctcgccgagcgttcgccg
gacacctcgccgcatcgcagcggcgagccctatcgtctggcggtgtcgggcatctatgcg
cggttagccgccaccgcgatgcggctcgaggtcgagaccacgcggccgccggtcggcaag
gccgagccgtatgcgagcgtcagcgagttccaggccgatctcgacgtgctcaaccgctca
ctgatcgcaaacaattccggcgtcatcgcgcgcggccggttgcggcagttgcggcgggcg
gtggattgcttcggcttccatctggcgcggctcgacatccggcagaactcggcggtgcat
gagcgcaccatcgccgagctgttcgacaccgccaatcccggcatgtcctacctcgcgctg
ggcgaggaggcgcgcgtcagcctgctgctcggcgagttgcgcagcgcgcggccgctggcc
tcgcccttcgtgaaatattccgaggagacccaaagcgaactcgccgtgttccgggccgcc
gccgaggcgcatggcaagtttggtcccgaggtgatctcgcaatgcatcatctcgatgtgc
aagggcatgtccgacatgctcgaggtcgcggtgctgctcaaggaggtcgggctcgtcaat
ccgtccggccgcagcgcgatcaacatcgtgccgctgttcgagaccatcgaggacctgcaa
gcttccagcggcatcatggaccggatgctggcgctgcacgactatcgcaggctggtcgac
agtctcggcggcgtccaggaagtgatgctcggctattccgacagcaacaaggatggcggc
ttcgtcacctcgggctgggagctctacaaggccgagatcggcctggtcgaggtgttcgag
cgccacggcatgcggctgcggctgttccacggccgcggcggctcggtcggccgcggcggc
gggccgagctatgacgcgatcatcgcgcagcccggcggcgcggtgaacggccagatccgc
atcaccgagcagggcgagatcatctcctcgaaatattccaatgccgaggtcggccgcagc
aatctggagatcctcgccgcggcgacgctggaaaccagcctgttgcagccgcgacagagc
gcgccgcgtccggaatatctcaaggcgatggaggaaatctccgcgctcgccttcaaggcc
tatcgcgggctcgtctatgagacgccgggatttgccgattacttctggggctcgaccgtc
atcaacgagatcgcgaccttgaacatcggcagccgtccggcctcgcgcaagaagacccgc
gagatcgaggacctgcgcgcgattccgtgggtgttctcctgggcgcaatgccggctgatg
ctgccgggctggtacggcttcggtgccgcggtcgagacctggatcgcggagcatccggag
cagggcatgccgttcctgcaggagctctacaaggagtggccgttcttccgcacgctgctc
tccaacatggacatggtgctggcgaagagctcgatcgcgatcgcctcgcgctatgccgag
ctggtgccggacgtcgcgctgcgcgagaagatattcggccagatccgccgcgaatggcat
ttgtcgatcgagacgctgctcgacatcatgggccacgaccggctgctgcaaggcaacccg
ctgctggagcgcggcatccgcaaccgcttcccctacatggacccgctcaaccacgtgcag
gtcgagctgttgaaggagcatcgcgcgcagaacccggacgagcaggtgctgcgcgggatt
cagatcacgatcaacgggatctcggcggggttgagaaatagcggttaa

DBGET integrated database retrieval system