KEGG   Bradyrhizobium sp. SK17: CWS35_19320Help
Entry
CWS35_19320       CDS       T05325                                 

Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00290  Valine, leucine and isoleucine biosynthesis
brk00770  Pantothenate and CoA biosynthesis
brk01100  Metabolic pathways
brk01110  Biosynthesis of secondary metabolites
brk01130  Biosynthesis of antibiotics
brk01210  2-Oxocarboxylic acid metabolism
brk01230  Biosynthesis of amino acids
Module
brk_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
brk_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    CWS35_19320
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CWS35_19320
Enzymes [BR:brk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     CWS35_19320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AUC96156
UniProt: A0A2K8YES9
LinkDB All DBs
Position
complement(4216750..4218594)
Genome map
AA seq 614 aa AA seqDB search
MPAYRSRTTTHGRNMAGARGLWRATGMKNEDFGKPIIAVVNSFTQFVPGHVHLQNLGQLV
AREIEKAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSRELIADSVEYMVNAHCADAMVCIS
NCDKITPGMLMATLRLNIPTVFVSGGPMESGKILLKGKKRAVDLIDAMVAAADSNVTDEE
VEAIERSACPTCGSCSGMFTANSMNCLTEALGLALPGNGSVLATHADRKSLFVEAGHLIV
DLARRYYEQDDAKVLPRNIANFKSFENAMTLDIAMGGSTNTVLHLLAAAREGEVPFTMND
IDRLSRKVPVLCKVAPSVQDVHMEDVHHAGGIMAILGELDRAKLLTTDGPTVHSTTLDDA
LNRWDVMRTSSDKVRNFYCAAPGNVPTQEAFSQNSRFDEVDADRENGVIRNAAHAYSKDG
GLAVLFGNLAEDGCIVKTAGVDQSILKFSGPARIFESQDAAVEGILTNKVKAGDVVLIRY
EGPRGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGSSGLSIGHVSPEAAEGGLIGL
AEEGDIVEFDIPNRKVHLAVDDAELKRRRAAMDAKGNAAWKPAAPRKRAVSTALKAYAAF
ASSAAKGAVRILPE
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcctatcgctcccgcaccaccacccacggccgcaacatggcgggtgcacgcggc
ctctggcgcgccaccggcatgaagaacgaggatttcggcaagccgatcatcgcggtggtc
aattccttcacccagttcgtgcccggccatgtccatttgcagaatctcggccagctggtg
gcgcgcgagatcgagaaggccggcggcgttgccaaggagttcaacaccattgcggtcgac
gacggcatcgcgatgggccatgacggcatgctctacagcctgccctcgcgcgagctgatc
gccgacagcgtcgaatacatggtcaacgcgcattgcgccgacgccatggtctgcatctcc
aactgcgacaagatcacgcccggcatgctgatggcgacgctgcgcctgaacatcccgacc
gtgttcgtctcgggcggcccgatggagtcgggcaagatcctgctcaagggcaagaagcgc
gcagtcgacctgatcgacgccatggtcgcggccgccgattccaacgtcacggatgaagag
gtcgaggccatcgagcgctcggcctgcccgacctgcggctcctgctccggcatgttcacc
gcgaattcgatgaactgcctgaccgaggcgctcggcctggcgctgcccggcaacggctcg
gtgctggcgacccatgccgaccgcaagagcctgttcgtcgaggccggccatctgatcgtc
gatctggcccgccgctattacgagcaggacgacgccaaggtgctgccgcgcaacatcgcg
aacttcaagtcgttcgagaacgcgatgacgctcgacatcgcgatgggcggttcgaccaac
accgtgctgcatttgctcgccgcggcgcgcgaaggcgaagtgccgttcacgatgaacgac
atcgaccggctttcccgaaaggtgccggtgctctgcaaggtcgcgccctcggtgcaggac
gtccacatggaggacgtgcatcacgccggcggcatcatggcgatcctcggcgagctcgac
cgcgccaagctgctcaccaccgacggcccgaccgtgcacagcacgacgctggacgacgcg
ctgaaccgctgggacgtgatgcggacatcaagcgacaaggtgcgcaacttctactgcgcc
gcaccgggcaacgtgccgacccaggaggctttcagccagaacagccgcttcgatgaggtc
gacgccgatcgcgagaacggcgtgatccgcaacgccgcgcatgcctattccaaggacggc
ggcctcgccgtgctgttcggcaatcttgccgaggacggctgcatcgtgaagaccgccggc
gtcgaccagagcatcctgaagttctcaggcccggcgcgcattttcgagagccaggacgcg
gcggtcgagggcatcctcaccaacaaggtgaaggccggcgacgtggtgctgatccgctat
gagggtccgcgcggtggtccgggcatgcaggagatgctgtatccgaccagctatctgaag
tcgaaggggctcggaaaggcctgcgcgctgatcaccgatggccgcttctccggcggatcg
tcgggcctgtcgatcggccacgtctcgcctgaagccgccgaaggcggcctgattggtctc
gccgaggaaggcgacatcgtcgagttcgacatcccgaaccgcaaggtccacctcgcggtc
gacgatgccgagctcaagcgtcgccgtgcggcgatggacgccaagggcaacgccgcgtgg
aagccggcggcaccgcgcaagcgcgccgtctccaccgcgctgaaggcctacgcggcattc
gcgagcagcgccgccaagggcgcggtgcgcatcctgccggagtga

DBGET integrated database retrieval system