KEGG   Bradyrhizobium sp. SK17: CWS35_19480Help
Entry
CWS35_19480       CDS       T05325                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00630  Glyoxylate and dicarboxylate metabolism
brk00710  Carbon fixation in photosynthetic organisms
brk01100  Metabolic pathways
brk01120  Microbial metabolism in diverse environments
brk01200  Carbon metabolism
Module
brk_M00165  Reductive pentose phosphate cycle (Calvin cycle)
brk_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CWS35_19480
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CWS35_19480
Enzymes [BR:brk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CWS35_19480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small P3A
Motif
Other DBs
NCBI-ProteinID: AUC96181
UniProt: A0A2K8YEY3
LinkDB All DBs
Position
4256326..4256751
Genome map
AA seq 141 aa AA seqDB search
MRVTQGCFSFLPDLTDEQIAAQVQYCLDKGWAVNIEFTDDPHPRNTYWDMWGLPMFDLRD
AAGIMKELADCRRVYGERYIRMSGFDSSHGWESVRISFIVNRPKNEPGFRLERQEVGGRS
VSYTTRAYALDRPEGERYADQ
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgagagtgacccaaggctgcttttctttcctgcccgatctcaccgatgagcagatcgca
gcgcaggtgcaatactgcctcgacaagggctgggcggtgaacatcgagttcaccgacgac
ccacatccccgcaacacctattgggacatgtggggtctgccgatgttcgacctgcgcgat
gccgccggcatcatgaaggaactcgccgattgccgccgtgtctatggcgagcgctacatc
cgcatgagcgggttcgattcttcccatggctgggaatccgtgcgcatctccttcatcgtc
aaccggccgaagaatgagcccggcttccggctcgagcggcaagaggtcggcggccggagc
gttagttatacgaccagggcttacgcgctggatcgccccgagggcgaacgctacgcagat
cagtga

DBGET integrated database retrieval system