KEGG   Bradyrhizobium sp. SK17: CWS35_28485Help
Entry
CWS35_28485       CDS       T05325                                 

Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00030  Pentose phosphate pathway
brk00710  Carbon fixation in photosynthetic organisms
brk01100  Metabolic pathways
brk01110  Biosynthesis of secondary metabolites
brk01120  Microbial metabolism in diverse environments
brk01130  Biosynthesis of antibiotics
brk01200  Carbon metabolism
brk01230  Biosynthesis of amino acids
Module
brk_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
brk_M00165  Reductive pentose phosphate cycle (Calvin cycle)
brk_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CWS35_28485
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CWS35_28485
Enzymes [BR:brk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     CWS35_28485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-ProteinID: AUC97746
UniProt: A0A2K8YJB9
LinkDB All DBs
Position
complement(6147133..6147831)
Genome map
AA seq 232 aa AA seqDB search
MDMDALKRQAAARALEEVRDGMKLGLGTGSTAKHFVELLGDKVRSGLKVIGVPTSEATRA
DAIRCGVPLTTLDEVDHLDLTVDGADEIDPALNLIKGGGGALLREKIVAAASARMIVIAD
DSKWVDVLGRFPLPVEVIPFGLRATRAAMARAFAEAGVSGEMVIRKGKDGHVFVTDGGHW
IVDAHLGRIGDPPRLANLLSAIPGVVEHGLFIGLGSVAILAGAQGIRVVERR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
gtggatatggatgcactgaaacgccaggcggcggcgcgtgcgctcgaagaggtgcgcgac
ggcatgaagctcgggctcggcaccgggtcgaccgccaagcatttcgtcgaactgctcggc
gacaaggtccgctcgggcctgaaggtgatcggcgtgccaacttcggaggcgacacgggcg
gatgcgatccgctgtggcgtgccgctgaccacactcgacgaggtcgaccatctcgacctt
accgtcgacggcgccgacgagatcgaccccgcgctcaatttgatcaagggcggcggcggc
gcgctgctgcgcgagaagatcgtggcggccgccagtgctcgcatgatcgtgattgccgat
gacagcaaatgggtcgacgtgctcggacgctttccgctgccggtcgaggtgattccgttc
gggctgcgcgcgacccgggccgcgatggcgcgggcgttcgccgaagccggcgtgtccggc
gaaatggtcatccggaagggcaaggacggtcacgtttttgtcaccgatggcggccactgg
atcgtcgatgcccatctcggccggatcggcgacccgccgcgtcttgccaatctgctcagc
gccataccgggcgtggtcgagcacggcctgttcatcgggcttgggagcgtcgccattctg
gccggcgcgcagggaattcgggttgttgaacggcgatga

DBGET integrated database retrieval system