KEGG   Bradyrhizobium sp. SK17: CWS35_30175Help
Entry
CWS35_30175       CDS       T05325                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00010  Glycolysis / Gluconeogenesis
brk00620  Pyruvate metabolism
brk01100  Metabolic pathways
brk01110  Biosynthesis of secondary metabolites
brk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CWS35_30175
   00620 Pyruvate metabolism
    CWS35_30175
Enzymes [BR:brk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     CWS35_30175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AUC98037
UniProt: A0A2K8YK78
LinkDB All DBs
Position
complement(6520341..6521858)
Genome map
AA seq 505 aa AA seqDB search
MNKVDMQSVLKAPFAKRYGNFIGGEWREPHSGKYFDNVSPVTGLPICEIPRSDAADIEAA
LDAAHAAKDAWGKTSVAERSLILNKIADRMEANFEKLATAETWDNGKPIRETMAADMPLA
IDHFRYFASAIRGQEGSISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMATWKLAPALAA
GNCVVIKPAEQTPASIMTWLELVGDLLPKGVVNVVNGFGLEAGKPLASSNRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVCAEDDDFFDKAIEGFVMFALNQGEVC
TCPSRALIHESIYDRFMERALKRVAAITQGSPLDPSTMIGAQASSEQLEKILSYIDIGKK
EGAKVLAGGERNNLGGGLSGGYYVKPTVFEGNNKMRVFQEEIFGPVVSVATFKTDEEALS
IANDTLYGLGAGVWSRDANRCYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGVGRENH
KMMLDHYQQTKNMLVSYSAKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggttgacatgcagtccgtgctcaaggcgccgtttgccaaacgctatggcaat
ttcatcggcggcgaatggcgcgagccccattccggaaaatatttcgacaacgtatcgccg
gtcacgggacttccgatctgcgagatcccgcgctcggatgcggccgacatcgaggccgcg
ctggacgcagcgcatgcggcgaaggacgcctggggcaagaccagcgtcgccgagcgctcg
ctgatcctcaacaagatcgccgaccggatggaggccaatttcgagaagctcgcaacagcc
gagacctgggacaatggcaagccgatccgcgagaccatggccgccgacatgccgctcgca
atcgatcacttccgctacttcgcgagcgcgatccgcggccaggagggctcgatctccgag
atcgaccatgacaccgtggcctatcatttccacgagccgctcggcgtggtcggacagatc
attccctggaatttcccgatcctgatggcgacctggaagctggcgcctgcgctggccgcc
ggcaattgcgtggtcatcaagccggccgagcagaccccggcctcgatcatgacctggctt
gagctggtcggcgatctcctgcccaagggcgtcgtcaatgtcgtcaacggctttggtctc
gaggccggcaagccgctggcgtcgtcgaaccggatcgccaagatcgccttcaccggcgag
accacgacgggccggctgatcatgcaatacgcctcgcagaacctgatcccggtgacgctc
gaactcggcggcaagtcgcccaacatcttcttcaaggacgtctgcgcggaagatgacgat
ttcttcgacaaggcgatcgaaggcttcgtgatgttcgcgctcaaccagggcgaggtctgc
acctgtccgagccgggcgctgatccatgaatcgatctacgaccgcttcatggagcgcgcg
ctgaagcgcgtcgcggcgatcacgcaaggcagcccgctcgacccgtcgacgatgatcggc
gcacaggcgtcctccgagcagctcgagaagattctgtcctacatcgacatcggcaagaag
gaaggcgccaaggtgctggccggcggcgagcgcaacaatctcggcggcggactgtcgggc
ggctattacgtcaagccgaccgtgttcgagggcaacaacaagatgcgcgtgttccaggag
gagatcttcgggccggtggtgtcggtcgcgaccttcaagaccgatgaagaggcgctctcg
atcgccaacgacacgctctatggcctcggtgccggcgtctggagccgcgatgccaatcgc
tgctaccggttcggtcgcgcgatccaggccggccgggtctggaccaactgctatcatgcc
tatccggcgcacgcggcgttcggcggctacaagcagtccggcgtcggccgagagaaccac
aagatgatgctcgaccactatcagcagaccaagaacatgctggtgagctatagcgccaag
aagctcggcttcttctga

DBGET integrated database retrieval system