KEGG   Bradyrhizobium sp. SK17: CWS35_32535Help
Entry
CWS35_32535       CDS       T05325                                 

Definition
(GenBank) peptide ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:brk00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CWS35_32535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brk02000]
    CWS35_32535
Transporters [BR:brk02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    CWS35_32535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N IstB_IS21
Motif
Other DBs
NCBI-ProteinID: AUC98455
UniProt: A0A2K8YLE9
LinkDB All DBs
Position
7006766..7007746
Genome map
AA seq 326 aa AA seqDB search
MTTAPLIEVEELRIDLDGGARQVAAVEGVSFRIDRGETFGLVGESGCGKSITALAVIGLL
RRPLSIAAGVIRFDGREIQRLPGAEQRALRGNRIAMIFQEPMTALNPVSPVGRQIAEMFV
LHKGKSWREANQLAVEALANVRVPAPERRVKDYPHQLSGGMRQRVMIAIALACDPDLLIA
DEPTTALDVTVQAEIIELMRNLCAERGTAILMISHDLGLVANVCRRVGVMYAGRIVEERG
SDDIFRAGAHPYTQGLVDSLPRLGSRAALGRSRLKEIAGVVPAIADFPAGCRFNPRCAQA
TEICRTTVPETTWLDAGGLVRCHHHA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgccccgctgatcgaagtcgaggagctgcgcatcgatctcgatggcggcgcc
aggcaagtcgcggcggtcgagggcgtttcattccgtatcgatcgcggcgagacattcgga
ctggtcggcgagtccggctgcggcaagagcatcacagcgctcgccgttatcggcctgctg
cgtcggccgctctcgatcgccgccggcgtcatccgcttcgacggccgcgagatccagcgg
ctgccgggcgccgaacagcgcgcactgcgcggcaaccgcatcgccatgatcttccaggaa
ccgatgacggcactcaatccagtctcgccggtcggtcgacagatcgcggaaatgttcgtg
ctgcacaagggcaagagctggcgcgaggcaaaccagctcgccgtcgaagcgctggcgaat
gtccgcgtccccgcgccggagcggcgggtgaaggattacccgcaccagctttccggcggc
atgcgccagcgtgtgatgatcgcgatcgcactggcctgcgatccggatcttctgatcgcc
gacgagccgaccaccgcgctcgacgtaacagttcaggccgagatcatcgagctgatgcgc
aatctgtgcgccgagcgcggcaccgcgatcctgatgatcagccacgatctcgggcttgtc
gccaatgtctgccgtcgcgtcggcgtgatgtatgccggtcgcatcgtcgaggagcgcggc
tccgatgacatcttccgcgccggcgcgcatccctacacgcagggcctggtcgattcgctg
ccgcggctcggaagccgcgcggcgcttggccggtctcggctcaaggaaatcgctggagtc
gtgccggcgatcgcggatttcccggccggctgccgcttcaatccgcgttgcgcccaggcg
accgagatctgccggaccaccgtgccggagacgacgtggctcgatgcaggcggactggtc
aggtgtcaccatcatgcctga

DBGET integrated database retrieval system