KEGG   Bradyrhizobium sp. SK17: CWS35_34455Help
Entry
CWS35_34455       CDS       T05325                                 

Gene name
treS
Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00500  Starch and sucrose metabolism
brk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CWS35_34455 (treS)
Enzymes [BR:brk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CWS35_34455 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CWS35_34455 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AUC98779
UniProt: A0A2K8YMA9
LinkDB All DBs
Position
7413853..7417158
Genome map
AA seq 1101 aa AA seqDB search
MNVFSSVNTEVKIATETADQLWYKDAIIYQLHVKAFADSNNDGIGDFAGLTEKLGYLQEL
GVTALWLLPFYPSPGRDDGYDIGDYGDINPDFGTMKDFKRFIQEAKKRGLRVITELVVNH
TSDQHPWFKRARRSPPNSSARSWYVWSDTDQKYLDTRIIFTDTEKSNWTWDPEAGQFYWH
RFFSHQPDLNFDNPRVVRAIVQVMKRWLDTGVDGFRLDAIPYLCERDGTNNENLPETHAI
IKRLRQELDAYAKGKILLAEANQWPEDVQEYFGHGDECHMAYHFPLMPRIYMAIAQEDRF
PITDILRQTPDIPAACQWALFLRNHDELTLEMVTDVERDYLWSTYANDPRARINVGIRRR
LAPLMDNDRRKIELMNSLLLSFPGTPIIYYGDEIGMGDNIYLGDRNGVRTPMQWSPDRNG
GFSRADPARLYAPMIMDPVYGYESVNVEAQSRSLSSLLSATKRLIAVRKSTLAFGRGTMT
FIRPENRSVLAYVRQYQDKVILCVANLSRSAQATELDLSAFKDRVPLELLGRTRFPAIGE
LPYMITLAPYGFYWFELQERDKSEPVKPRAVPEFETLVVPLNSTWTSLARERGVFEHEVL
PGHLARSRWYPEHSVKAIQPKLVSAIPFCDIGDNRPWLIFFETTERSTTSRYVLPMQIEW
VRFDRERYNPRAFAAVRQGAREGTLLDVATDQIFTGLFLRNLRENLTVDEGEQGLKLEFR
PTSRFSDRPVRQPERIRVFENDQPHSTALVDNEYVTKIYRKLEVGINPEIEMGRFLTEVV
GFPNTPALLGTSELVEGDKRSAIAVLHTMIVNQGDLWTVAAAHLDRLVERQRLLAVSEHP
AENGDQATYLRHLSHSGKRLAELHLALASNRDLPDFAPEPTKPEDLQRWADEIMARAERV
FDTLKQRRSSLREPDRLLADQLQARHDMLPERLKALLPRETDGLNIRHHGDLHLGQLLVV
KDDVFIIDFDGGPGRTIAERRRKAPPARDVAGLIRSIDYAATAALERALRVAPDDSGRLS
LALAEWRDRAADAFLAAYRETMAGQRLWPSEPKAADRLLNFFLLEKAFYEIEYELANRPD
WLRVPLTGLLRILAQQPHEGA
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttttctcctccgtcaataccgaggtgaagatcgcgaccgagaccgcggatcag
ctctggtacaaggacgcgatcatctaccagctgcacgtcaaggcgtttgccgacagcaac
aatgacggcatcggcgacttcgccgggctgacggagaagctcggctatctacaggagctc
ggcgtcaccgcgctgtggctgttgccgttctatccgtcgcccggccgcgacgatggctac
gacatcggcgattatggcgacatcaatcccgatttcggcacgatgaaggacttcaagcgc
ttcatccaggaggccaagaagcgcggcctgcgcgtcatcaccgaactcgtcgtcaaccac
acctcggaccagcatccgtggttcaagcgcgcgcgccgcagcccgccgaattcgagcgcg
cgcagctggtacgtctggagcgacaccgaccagaaatacctcgatacgcggatcatcttc
accgataccgaaaagtcgaactggacctgggatccggaagccggccagttctactggcac
cgcttcttctcgcaccagccggacctcaatttcgacaatccccgcgtggtgcgggccatc
gtgcaggtgatgaagcgttggctcgacaccggcgtcgacggcttccggctcgacgccatc
ccctatctgtgcgagcgcgacggcaccaacaacgagaatctgccggagacgcatgccatc
atcaagcggctgcgccaggaactcgacgcctatgccaagggcaagatcctgctggccgag
gccaatcaatggccggaggacgtgcaggagtatttcggccatggcgacgaatgccacatg
gcctatcacttcccgctgatgccgcgcatctacatggcgatcgcccaggaagaccgcttt
ccgatcaccgacatcctgaggcagacgcccgatatcccggcggcgtgccaatgggcgctg
ttcctgcgcaatcacgacgagctgaccctggaaatggtcaccgacgtcgaacgcgactat
ctgtggtcgacttatgccaacgacccgcgcgcccgcatcaatgtcggcatccgccgccgt
cttgcgccgctgatggacaacgaccgccgcaagatcgagctgatgaactcgctgctgctg
tcgtttcccggcacgccgatcatctattacggcgacgagatcggcatgggcgacaacatc
tatctcggcgaccgcaacggcgtgcggaccccgatgcagtggtcgccggaccgcaatggc
ggcttctcgcgcgccgacccggcgcggctgtacgcgccgatgatcatggacccggtctac
ggctacgaatcggtcaatgtcgaggcgcagtcgcgcagcctgtcgtcgctgctgtcggcg
accaagcggctgatcgcggtgcgcaagtcgacgctcgccttcggccgcggcaccatgacc
ttcatccgcccggagaaccgctcggtgctcgcctatgtcaggcagtaccaggacaaggtg
atcctgtgcgtcgccaacctgtcgcgctcggcgcaggcgaccgagctcgacctctccgcc
ttcaaggaccgcgtaccgctggaactgctggggcgcacgcgcttcccggcgatcggcgaa
ctgccctacatgatcacgctcgcgccctacggcttctactggttcgagttgcaggagcgt
gacaagtccgagccggtgaagccgcgcgcagtgccggagttcgagaccctggtggtgccg
ctgaattcgacctggacgtcgctggcgcgggagcgcggcgtgttcgagcacgaagtgctg
cccggccatctcgcacgctcacgctggtaccccgagcattccgtcaaggcgatccaaccg
aaactggtgtccgcgatcccgttctgcgacatcggcgacaaccggccatggctgatcttc
ttcgagaccaccgagcgtagcaccaccagccgttacgtgctgccgatgcagatcgaatgg
gtgcgcttcgatcgcgagcgctacaacccgcgcgccttcgccgcggtgcgccagggcgca
cgcgaaggcacgctgctcgatgtcgcgaccgaccagatcttcaccggcctgttcctgcgg
aatctgcgggaaaacctgacggtcgacgaaggcgaacagggcctgaagctcgaattccgt
ccgaccagccgcttctccgatcggccggtgcggcagcccgagcgtattcgtgtgttcgag
aacgatcagccgcattcgacggcgttggtcgacaacgaatatgtcaccaagatctaccgc
aagctcgaggtcggcatcaatccggagatcgagatgggccgcttcctcaccgaggtggtc
ggcttcccgaatacccctgctctgcttggcacgtccgaattggtcgagggcgacaagcgc
agtgcgatcgcggtgctgcatacgatgatcgtcaaccagggcgatctctggacggtcgct
gccgctcacctcgaccgcctggtcgaacggcaacgcctgctcgcggtgagcgaacatccg
gcggagaacggcgaccaggcaacctatctgcgccatttgtcgcatagcggaaagcgcctc
gcggaattgcatctggcacttgccagcaaccgcgatctgccggacttcgcgccagagccg
accaagccggaggacctgcaacgctgggccgacgagatcatggcgcgcgccgagcgcgtg
ttcgataccctgaagcagcggcgcagctccctgagggagcccgaccggctgctcgccgat
caattgcaggcccggcacgacatgctgccggagcggctcaaggcgttgctgccgcgcgag
accgatggcctcaacatccgccatcacggcgacctgcatctcggccagctgctggtggtc
aaggacgacgtcttcatcatcgatttcgacggcggaccgggccgcaccatcgcggagcgc
cgccgcaaggcaccgccggcccgcgacgtcgccggcctgatccgctcgatcgactatgcg
gcgaccgccgcgctggaacgggcgctcagggtcgctcccgacgacagcggcaggttgagc
ctcgccctggccgaatggcgcgaccgggccgcggacgccttcctggcagcctatcgcgag
accatggccggccagcggctgtggccctctgagcccaaggcggccgatcgtttgctcaac
tttttcctgcttgagaaagccttctacgagatcgagtatgagctggccaaccggccggat
tggctgcgggtgccgcttaccggcctgctgaggatcctggcgcaacagccgcatgagggt
gcatga

DBGET integrated database retrieval system