KEGG   Brevundimonas sp. LM2: BZG35_00320
Entry
BZG35_00320       CDS       T04750                                 

Definition
(GenBank) histidine kinase
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
brl  Brevundimonas sp. LM2
Pathway
brl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:brl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BZG35_00320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:brl01001]
    BZG35_00320
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:brl02022]
    BZG35_00320
Enzymes [BR:brl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BZG35_00320
Protein kinases [BR:brl01001]
 Histidine kinases
  OmpR family
   BZG35_00320
Two-component system [BR:brl02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   BZG35_00320
SSDB
Motif
Pfam: HATPase_c HisKA Sensor_TM1 Stimulus_sens_1 HAMP HATPase_c_3 Baculo_PEP_C HATPase_c_2 Spc7
Other DBs
NCBI-ProteinID: AQR60270
UniProt: A0A1S6EQB5
LinkDB
Position
70242..71867
AA seq 541 aa
MASAIVTARADTLDGQDDAPLRRRLIRFGGSRLGGLILALNLLSLLILFGGALALNQWDR
GLVQARQESLMVQAELLSNVLGQLGITGGEPTPALDQIQASRWLRDNFIPTGQRARLYDS
DGLLVSDSYAVSDEIPGEPLPPSLPAGSPPVVTTDPVQDQADLARANIALGEEIEAALAG
EPQATVRRSEEGARVVSVSLPVRHVQQVLGVLTLEAGDVDQILSAQRRALVPFALVALAV
NLLASLLLHLFVARPVMRLSAAADQVRLQRARAISLPDLEDRKDEIGDLARSLESMTETL
SDRMDAIERFAADVSHEIKNPLTSIRSALETLDLVQDQDKRDRLTRVLQQDVRRLDRLIT
DISNASRLDAELSRDRPRPVDLAALLTDIVNVYETTAKPGEAPVRLALTTDGAARVLGRD
GPLGQVFRNLIDNARSFSPPGRAVRVTVLRDEGEPDRALAIRVEDDGPGIPSENLETVFE
RFYTSRPRGTAFGSNSGLGLSIVKQIVEAHGGRVVATNRVEPDGRIAGARFEVTLPSTGR
R
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggcgtcggctatcgttaccgcgagagctgacacgctcgatggtcaggacgatgcgcca
ctgcgccgtcggctgatccgcttcggcggatcccggctgggtgggctgatcctcgcgctc
aacctcctgagcctgctgatcctgttcgggggcgccctggcgctgaaccagtgggatcgc
ggcctggtgcaggcgcgtcaggaaagcctgatggtccaggccgagctgctgtcgaacgtg
ctgggccagctgggcatcaccggcggggaaccgacgccggccctggatcagatccaggcc
agccgctggctgcgcgacaacttcattccgaccggccagcgcgcgcggttgtacgacagc
gacggcctgttggtgtcggacagctatgccgtctctgacgagatccccggcgagccgctg
ccgccctccctgccggcggggtcgccgccggtcgtgacgaccgatcccgtgcaggatcag
gccgacctcgcccgtgccaatatcgcgctcggcgaagagatcgaggccgctttggcgggc
gagccccaggcgaccgtgcgacgctccgaggaaggggcccgggtcgtctcggtctccttg
ccggtgcgccatgtccagcaggttctgggcgtgctgacgctggaggccggcgacgtcgac
cagatcctcagcgcccagcgccgggccctcgtgccgttcgccctggtggccctggcggtg
aacctgctggcctcgctgctgctgcatctgttcgtggcccggcccgtcatgcgcctgtcg
gccgcggcggatcaggtccggctgcagcgggcccgcgccatctccctgcccgacctggag
gaccgcaaggacgagatcggcgatctggcgcggtcgctggagtcgatgaccgagaccctg
tccgaccggatggacgccatcgagcggttcgccgccgatgtgtcgcatgagatcaagaac
cccctgacctcgatccgttcggcgctggaaacgctcgatctggtgcaggatcaggacaag
cgcgaccggctgacccgggtgctgcaacaggacgtcagacgcctggaccggctgatcacc
gacatctccaatgcctcgcgtctggacgccgaactgtcccgcgaccggccgcggccggtc
gatctggcggccctgctgaccgatatcgtcaatgtctatgaaaccacggccaagcccgga
gaagcgcccgtgcggctggcgctgacgacggacggcgcggcccgggtcctgggtcgcgac
ggtcccctgggccaggtgttccgcaacctgatcgacaacgctcgatcgttcagcccgccc
ggcagagcggtccgcgtgaccgtgttgcgcgacgagggcgagccggaccgcgccctggcg
atccgggtcgaggacgacggacccggcattccgtccgaaaacctcgagacggtgttcgaa
cgtttctacacctcgcgcccgcgcgggacggccttcgggtccaactccggactgggcctg
tcgatcgtcaagcagatcgtcgaggcgcacgggggacgggtggtcgcgacgaaccgcgtg
gagccggacggccgtatcgcgggcgcgcggttcgaggtcaccctgccctccaccggtcgc
cggtga

DBGET integrated database retrieval system