KEGG   Brevundimonas sp. LM2: BZG35_01145Help
Entry
BZG35_01145       CDS       T04750                                 

Definition
(GenBank) NTP pyrophosphohydrolase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
brl  Brevundimonas sp. LM2
Brite
KEGG Orthology (KO) [BR:brl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:brl03400]
    BZG35_01145
Enzymes [BR:brl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     BZG35_01145
DNA repair and recombination proteins [BR:brl03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BZG35_01145
 Prokaryotic Type
    BZG35_01145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX_4 NUDIX
Motif
Other DBs
NCBI-ProteinID: AQR60416
UniProt: A0A1S6EQZ6
LinkDB All DBs
Position
complement(225818..226234)
Genome map
AA seq 138 aa AA seqDB search
MTPSPLPPTVLVVAAALVDVDGRVLIAKRPEGKALAGLWEFPGGKVEAGERPEAALIREL
QEELGIDVQEACLAPFVFASHSYDSFHLLMPLYLCRRWSGVVVAREHAALAWVRPNALSD
YPMPPADAPLVAWLRDLL
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgacgccctcgcccctcccgcccaccgtcctcgtcgtcgccgctgccctggtggatgtg
gacggccgggtgctgattgccaagcggccggagggcaaggccctggcggggttgtgggag
tttccggggggcaaggtcgaggccggggaacgccccgaggccgccctgatccgagaactg
caggaggagctggggatcgacgtgcaggaggcctgtctggccccgttcgtttttgccagc
cactcttacgattcgtttcaccttctcatgccactctacctgtgccggcgctggtccggc
gtggtcgtcgcgcgcgagcacgccgcactggcctgggtgaggcccaacgccttgtcggac
tatcccatgcccccggccgacgcccctctggtggcctggctgcgggacctgctctga

DBGET integrated database retrieval system