KEGG   Brevundimonas sp. LM2: BZG35_02950Help
Entry
BZG35_02950       CDS       T04750                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
brl  Brevundimonas sp. LM2
Pathway
brl00620  Pyruvate metabolism
brl00680  Methane metabolism
brl01100  Metabolic pathways
brl01120  Microbial metabolism in diverse environments
brl01200  Carbon metabolism
Module
brl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:brl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BZG35_02950
  09102 Energy metabolism
   00680 Methane metabolism
    BZG35_02950
Enzymes [BR:brl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BZG35_02950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AQR63321
UniProt: A0A1S6EZ52
LinkDB All DBs
Position
589602..592310
Genome map
AA seq 902 aa AA seqDB search
MPVSNAPVADDRLREEVRLLGGLLGEVIRDESGQDLYDRIEAVRVASVGYHRHAGARGSA
ELERLLSELSLDDAVGLAHGFAVFSLLANVAEDRAGKRRARSQTAEGARPDTPEGALARL
AQAGKSPDDARALLSEALISPVLTAHPSEVRRKSVIDRIATVSDLLDACDRDDLSCAPDV
MIAGLRRQTVILWATRLVRTSGLVVQDEIDTVVSFLERVFLKVAPEQLIDWRRRLDAPDL
KPFIRIGAWVGGDRDGNPNVDAAALRAAFATPAKAVLRHYLEAVNTLGAELSLSGSLAAV
SPAMRALAETSGDPSPHRADEPYRRALSHIYARLSATHPLLTGETAPRPAPFAAPPYDGP
EAFRADLAVLQDSLVAGHGAVFADDGLSRLIATVDVFGFHMATLDLRQNSDVHARVVSHL
LRVAGVCPDYAALDEESRIALLSAELAAPRLLFSPYEAYDPEVLKERAILQAAAEALRAF
GPQAIRTHIVSKTDAASDLLEVYLLLKEVGLYRHDDPAACPIQAAPLFETIDDLRAAKPT
LERLLREPSALAVARARGVQEVMIGYSDSNKDGSYLTSTWELHEASRALLSVTEAVGVLL
QLFHGRGGAVGRGGGSSFAGVISQPTGTVAGRIRITEQGEVIANKYGEPDVARRNLDALT
AGTLIASLAPPPDEAMTARHGNTASALSVASMAAYRALVYETPGFVDYFRAATPINEIAG
LKIGSRPTSRTASTAIEDLRAIPWVLSWSQSRVMLPGWFGFGSAVQGRDMGELRAMATDW
PFFRTLLQNMEMIMAKADMTIARRYASLVPDQALAATIFGALQSEWDRTRDAVLAITGQP
DLLGGQPELDRLIRLRMPYVEPLNHVQIELIRRRRAGDDDPRVREGILLTINGVAAGLRN
SG
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtatccaacgcccccgtcgccgacgaccgcctgcgcgaggaggtccgcctgctg
ggcgggctgctgggcgaggtgatccgcgacgagagcgggcaggatctctacgaccggatc
gaggcggtgcgggtggcgtcggtcggctaccaccgccacgccggggcgcgggggtcggcg
gagctggaacggctgctgtcggagctgtcgctggacgatgcggtggggctggcgcacggg
ttcgcggtcttttctctcctggccaatgtcgccgaggaccgggcgggcaagcgccgcgcc
cgcagccagaccgccgagggggcgcggcccgatacgcccgaaggggccctggcccggctg
gcccaggccggcaagtcccccgacgacgcccgcgccctgctgtccgaggccctgatctcg
ccggtcctgaccgcccacccgtccgaggtgcggcgcaagagcgtgatcgaccggatcgcc
accgtgtcggacctgctggacgcctgcgaccgggacgacctgtcgtgcgcgccggacgtc
atgatcgcgggcctgcgccgtcagacggtcatcctgtgggccacccggctggtgcggacc
tcgggcctggtggtccaggacgagatcgacacggtggtgtccttcctcgagcgggtgttc
ctgaaggtcgcgccggaacagctgatcgactggcggcggcgtctggacgccccggacctg
aagcccttcatccgcatcggggcctgggtcgggggcgaccgggacggcaatcccaacgtc
gacgccgccgccttgcgcgccgccttcgccaccccggccaaggccgtgctgcggcactat
ctggaggcggtgaacacgctcggggccgagctcagcctgtccggctcgctggcggccgtc
agcccggcgatgcgggccctggccgagacctcgggcgacccctcgccgcatcgggccgac
gagccctatcgccgcgcgctcagccacatctatgcccggctgtcggcgacccatcccctg
ctgacgggcgagaccgccccccgccccgcgcccttcgccgccccgccctatgacgggccc
gaggccttccgcgccgacctggcggtgctgcaggacagtctggtggccggccacggggcg
gtcttcgccgacgacggcctgtcgcgcctgatcgccacggtcgacgtgttcggcttccac
atggcgacgctcgatctgcgccagaactcagacgtccatgcgcgcgtcgtttcccatctt
ctgcgcgtcgccggcgtctgccccgactatgccgctctggacgaggagtctcggatcgcc
ctgctgtcggccgagttggctgcgccgcgtctgctgttcagcccctatgaggcctatgac
cccgaggtgctgaaggagcgggccatcctgcaggcggcggccgaggccctgcgcgccttc
gggccccaggcgatccgcacccatatcgtgtccaagaccgacgccgcctccgacctgctg
gaggtctatctgctgctgaaggaggtcggcctctatcgccatgacgaccccgcggcctgc
ccgatccaggccgcgcccctgttcgagaccatcgacgacctgcgcgccgccaagccgacg
ctggagcggctgttgcgggagccctcggccctggcggtggcccgggcgcggggcgtgcag
gaggtgatgatcggctattccgactccaacaaggacggctcctacctgacctcgacctgg
gagctgcacgaggcctcgcgggccctgctcagcgtcacggaggccgtcggcgtcctgctg
caactgtttcacggccggggcggggcggtcgggcgcggtggcggctccagcttcgccggc
gtgatctcccagccgaccggcaccgtcgcgggccggatccgcatcaccgaacagggcgag
gtcatcgccaacaagtacggggagccggacgtggcccgccgcaacctcgacgccctgacc
gccggcaccctgatcgcgtcgctggctccgccgccggacgaggcgatgacggccaggcat
ggcaacacggcgtccgccctgtcggtcgcctcgatggccgcctatcgggccctggtctat
gagacgccgggcttcgtcgactatttccgcgccgcgaccccgatcaacgagatcgccggg
ctgaagatcggctcccggccgacctcgcgcaccgcctccaccgccatcgaggacctgcgg
gccatcccctgggtgttgagctggagccagtcgcgggtcatgctgcccggctggttcggc
ttcggctcggcggtgcagggccgcgacatgggcgagctgcgcgccatggcgaccgactgg
cccttcttccgcaccctgctgcagaacatggagatgatcatggccaaggccgacatgacc
atcgcccggcggtatgcctctctggtaccggatcaggccctggcggcgaccatcttcggc
gccttgcagtctgaatgggaccggacccgcgacgcggtcctggccatcaccggccagccc
gatctgctgggcggccagcccgagctggacaggctgatccggctacgcatgccctatgtc
gagccgctgaaccacgtccagatcgagctgatccggcgtcggcgggccggggacgacgat
ccgcgcgtccgcgagggcatcctgctgaccatcaatggcgtggcggcgggcctcaggaac
agcggatga

DBGET integrated database retrieval system